Alyc018213.1
Basic Information
- Insect
- Agrochola lychnidis
- Gene Symbol
- LITAF_1
- Assembly
- GCA_963680765.1
- Location
- OY796857.1:17159135-17160632[-]
Transcription Factor Domain
- TF Family
- zf-LITAF-like
- Domain
- zf-LITAF-like domain
- PFAM
- PF10601
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family display a conserved zinc ribbon structure [3] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS)[2]. The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 1.5e-27 3.9e-24 86.0 11.6 3 69 74 139 72 140 0.94
Sequence Information
- Coding Sequence
- ATGAATCAGAACAATGGAGATTTTAATGATCCTAAAGGCCAGGGCATGCCTCCGCCATACACAGATGGGCCACCACCTCCTGTAACGGTCACCACACACGCACCGCACTCGTACCCAGCACAGCCGACCCAACCACCACCAGTTCATGGAGTAGTCTACCAAGGGAATATGGGTCCGACCGTCATCCCCGTGATGGTCGGTCCTCAGATGGGCCCCAAAGCATCGTCGATAACCTGCCGATCATGCAACCAGCAGATAATCACAAGGGTTGAATACAAGTCGTCAACGAAAACCCATTTGTTCGCTCTCCTGCTTTGTTTAGTGTTTTGGCCCTGTGTATGCCTACCCTACTGTTTGGACAGTTGCCACAACGCAGACCACTACTGTCCAAACTGCAACGCTTACATCGGCAGCTACACCAACTAA
- Protein Sequence
- MNQNNGDFNDPKGQGMPPPYTDGPPPPVTVTTHAPHSYPAQPTQPPPVHGVVYQGNMGPTVIPVMVGPQMGPKASSITCRSCNQQIITRVEYKSSTKTHLFALLLCLVFWPCVCLPYCLDSCHNADHYCPNCNAYIGSYTN
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00037441; iTF_01527937; iTF_00906722; iTF_01441603; iTF_00238377; iTF_01117923; iTF_01118904; iTF_00426020; iTF_00746381; iTF_00831793; iTF_00623684; iTF_01095525; iTF_00758825; iTF_01093705; iTF_00668108; iTF_01094574; iTF_00925400; iTF_00810665; iTF_00274914; iTF_00274116; iTF_00177748; iTF_00809725; iTF_00726987; iTF_01193291; iTF_01084801; iTF_01085970; iTF_00124845; iTF_00148144; iTF_00908465; iTF_00907544; iTF_00121062; iTF_01247725; iTF_00375928; iTF_00173839; iTF_00038355; iTF_01231227; iTF_01526683; iTF_01440652; iTF_00364575; iTF_00112188; iTF_01119905; iTF_00122015; iTF_00123898; iTF_00449791;
- 90% Identity
- iTF_00449791;
- 80% Identity
- -