Basic Information

Transcription Factor Domain

TF Family: HTH
Domain: HTH_psq domain
PFAM: PF05225
TF Group: Helix-turn-helix
Description: This DNA-binding motif is found in four copies in the pipsqueak protein of Drosophila melanogaster [1]. In pipsqueak this domain binds to GAGA sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.036 32 6.1 0.1 24 38 2 16 2 19 0.90

2 5 0.38 3.4e+02 2.8 0.0 24 35 23 34 23 41 0.84

3 5 0.04 36 6.0 0.0 24 36 45 57 45 63 0.87

4 5 0.015 13 7.3 0.0 24 38 67 81 67 84 0.90

5 5 0.04 36 6.0 0.0 24 36 88 100 88 106 0.87

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.036	32	6.1	0.1	24	38	2	16	2	19	0.90
2	5	0.38	3.4e+02	2.8	0.0	24	35	23	34	23	41	0.84
3	5	0.04	36	6.0	0.0	24	36	45	57	45	63	0.87
4	5	0.015	13	7.3	0.0	24	38	67	81	67	84	0.90
5	5	0.04	36	6.0	0.0	24	36	88	100	88	106	0.87

Coding Sequence: ATGAGACGATACAACGTGTCGCATCAGACGATACGACGTGTCGTATCAGACGATACGTGTCGCATCAGACGATACGACGTGTCGCATCAGACGATGCCACGTGTCGCATCAGACGATACGACGTGTCGCATCAGACGATACGACGTGTCGCATCAGACGATACGACGTGTCGCATCAGACGATACGACGTGCCACATCAGACGATACGACGTGTCGCATCAGACGATACGACGTGTCGTATCAGACGATACGTGTCGCATCAGACGATACGACGTGTCGCATCAGACGATACGACGTGTCGCATCAGACGATACGACGTGTCGCACTAGTTGA
Protein Sequence: MRRYNVSHQTIRRVVSDDTCRIRRYDVSHQTMPRVASDDTTCRIRRYDVSHQTIRRVASDDTTCHIRRYDVSHQTIRRVVSDDTCRIRRYDVSHQTIRRVASDDTTCRTS

Sequence clustering based on sequence similarity using MMseqs2