Aaln027309.1
Basic Information
- Insect
- Agelastica alni
- Gene Symbol
- E(spl)mgamma-HLH
- Assembly
- GCA_950111635.2
- Location
- OX467712.1:12257808-12258440[+]
Transcription Factor Domain
- TF Family
- bHLH
- Domain
- HLH domain
- PFAM
- PF00010
- TF Group
- Basic Domians group
- Description
- A basic helix-loop-helix (bHLH) is a protein structural motif that characterizes one of the largest families of dimerizing transcription factors.It should not be confused with the helix-turn-helix domain.The motif is characterized by two α-helices connected by a loop. In general, transcription factors including this domain are dimeric, each with one helix containing basic amino acid residues that facilitate DNA binding. In general, one helix is smaller, and, due to the flexibility of the loop, allows dimerization by folding and packing against another helix. The larger helix typically contains the DNA-binding regions. bHLH proteins typically bind to a consensus sequence called an E-box, CANNTG. The canonical E-box is CACGTG (palindromic), however some bHLH transcription factors, notably those of the bHLH-PAS family, bind to related non-palindromic sequences, which are similar to the E-box. bHLH TFs may homodimerize or heterodimerize with other bHLH TFs and form a large variety of dimers, each one with specific functions.https://en.wikipedia.org/wiki/Basic_helix-loop-helix
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 2.4e-16 2.6e-13 51.2 3.6 1 53 25 82 25 82 0.89
Sequence Information
- Coding Sequence
- atgtcatCGTACGAAATGATAACTCCGACTCCAGTGGAGGAATCGCAGCCGATATCCCGTACTTACCAGTACAGGAAAGTGATGAAACCGATGTTGGAAAGAAAACGACGAGCCAGAATCAACCGTTGTTTGGATGAATTGAAAGAATTAATGGTGACAGCTCTACAAAACGAAGGTGAGAACGTATCGAAACTAGAAAAAGCGGATATTCTAGAATTAACGGTACGTCATCTCCACAAATTaagaaaacaacaaagattaTCCACCAATCCAGTAATAGACGCAGACAGATTCAGAGCAGGCTACACTCATTGCGCCAACGAAGTATCCAGATGCCTGGCTTCTACTCCCGGCGTTGACATCCAACTAGGTACCAAGTTGATGACACATTTGGGACAACGACTTAACGAAATGGACAAGGTATCTCCTTTGATGATTCAAGTTAGTTCGCCTTACACGCCGCCTGGTTCTCCCAATTTGGAATGTGAAGTGTCCCATCACTATACCATGCCTTTGACGCCTTCTTCGTCCAGTTCCTCGAGGTGTAGTCCGTCGCCCGACCAACCCATGGACTGCTCCACGGCTGGTCTGTTAAAAGTTGTGCAAAAAGAGGAGGTATGGAGACCGTGGtga
- Protein Sequence
- MSSYEMITPTPVEESQPISRTYQYRKVMKPMLERKRRARINRCLDELKELMVTALQNEGENVSKLEKADILELTVRHLHKLRKQQRLSTNPVIDADRFRAGYTHCANEVSRCLASTPGVDIQLGTKLMTHLGQRLNEMDKVSPLMIQVSSPYTPPGSPNLECEVSHHYTMPLTPSSSSSSRCSPSPDQPMDCSTAGLLKVVQKEEVWRPW
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01126070;
- 90% Identity
- iTF_01295716;
- 80% Identity
- -