Amic025688.1
Basic Information
- Insect
- Agara michaeli
- Gene Symbol
- egg
- Assembly
- GCA_018245675.1
- Location
- DWDX01042599.1:1-1776[-]
Transcription Factor Domain
- TF Family
- MBD
- Domain
- MBD domain
- PFAM
- PF01429
- TF Group
- Unclassified Structure
- Description
- The Methyl-CpG binding domain (MBD) binds to DNA that contains one or more symmetrically methylated CpGs [2]. DNA methylation in animals is associated with alterations in chromatin structure and silencing of gene expression. MBD has negligible non-specific affinity for DNA. In vitro foot-printing with MeCP2 showed the MBD can protect a 12 nucleotide region surrounding a methyl CpG pair [2]. MBDs are found in several Methyl-CpG binding proteins and also DNA demethylase [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 0.11 6e+02 0.8 0.1 28 38 18 42 4 44 0.62 2 2 4.1e-13 2.3e-09 37.3 0.0 5 75 75 138 71 140 0.91
Sequence Information
- Coding Sequence
- GAGGCGGACGTGTGCCGGCGCGCGGTTGCCAAGAAGTCGACGGGCGCTCCGCCCCcaccgccgcccgccgcgccacCCGCACAGAACCTCGACAACATAACCAGCCGCGTCGTGTACTACACGCCGAAGCACTCGATCCGGCCGCACAGGATCGTGCCGCACACGTGCGGGCCCGCCTGCAACCGCACCGACGTGCTGCCGCTGCACGAGCTCAAGACCTACAACCCGCTCGCCAAGCCGCTACTCAGCGGTTGGGAGAGACAGATAGTGCGGTACAAGGGCGCGAAGGCAGTGGCGTACCGCGCGCCGTGCGGGCGGCGCGTGCGCGGCGAGCGCGAGCTGCACCGCCTGCTGCGGGCCACGCGCGCCGACCTGCCGCTGGACCTGTTCGACTTCGCGCCGCACACACACTGCCTCGCCGAGTTCGTGCTCAACAAGTGCCTCATCATGAAGAAG
- Protein Sequence
- EADVCRRAVAKKSTGAPPPPPPAAPPAQNLDNITSRVVYYTPKHSIRPHRIVPHTCGPACNRTDVLPLHELKTYNPLAKPLLSGWERQIVRYKGAKAVAYRAPCGRRVRGERELHRLLRATRADLPLDLFDFAPHTHCLAEFVLNKCLIMKK
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -