Adec028393.1
Basic Information
- Insect
- Adalia decempunctata
- Gene Symbol
- -
- Assembly
- GCA_951802165.1
- Location
- OX637701.1:2578499-2579436[-]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 5 0.026 3.7e+02 2.5 0.0 25 36 125 136 109 148 0.66 2 5 0.36 5.1e+03 -1.1 0.0 27 51 158 182 155 185 0.72 3 5 0.0031 45 5.5 0.3 23 44 182 203 176 207 0.88 4 5 1e-05 0.15 13.4 0.0 21 52 208 239 203 239 0.89 5 5 0.0016 24 6.4 0.0 21 48 236 263 234 267 0.88
Sequence Information
- Coding Sequence
- ATGGACTACGATTCTGAAGATTCCTACGATGGTTATCCCTTGGAGCCCATGATTTTGATCAATGATGGTGAAGAAGAAAATGATGACAGAACGATTGAAACAGATGAAAAATGCGACACAGAATTGGCACCATTTGTTGGTCCAGATATATCCATAATACCACTGAAGAGAAAGAAAccgctattcaaaataaaactttttgAACGGAAACCTGAAGTGAAACGAAAACCTTCATACTCTGATGACGAGATACCTTACGAAGATGATCAAGGTACCCGCAGGAGAGGGGCAAGAAATACAGTTCGAATTATAACCAAAGAAGAAGCAGAAAACACGTCTGAACCATATCCCAAAAGAAAATCTCTACCCCTTGAAAAATGCCCCATTTGCAAGAAATTCTTCAGGAGGATGGCCACTCACTTGACCAAACACCAAGATATAGATCCCAACTTGCAAAACAACGGTTTAGAATGTAGTTTTTGCCAGAAAACTTTCAACACTCAAAGTAACCTGCATATTCATTTGAGAACTCACACAGGTTTGAAACCTTATGTTTGTCAAATTTGCGGGAAAGCGTTTTCGCAGTCGTGCAATTTAGTGAATCACACGAGAATACACAGCGGGGAAAAACCTTTCAAATGTCCGCATTGCGACAAAGCTTTCACCCAGTCCGGTAATTTAAATAACCACATAAGACTCCACACGAACGAGAAACCTTTCAAGTGCCATTTTTGCGACAAGGCTTTCGTACAGTCGGGAAATTTGAACTCGCATATTATGAATAATCACAGATCTAGGGAATTTCCCAGTTATTTAGAGCCTAGTTTATCTGAATCTATTTCAAATCAAACAATTTGA
- Protein Sequence
- MDYDSEDSYDGYPLEPMILINDGEEENDDRTIETDEKCDTELAPFVGPDISIIPLKRKKPLFKIKLFERKPEVKRKPSYSDDEIPYEDDQGTRRRGARNTVRIITKEEAENTSEPYPKRKSLPLEKCPICKKFFRRMATHLTKHQDIDPNLQNNGLECSFCQKTFNTQSNLHIHLRTHTGLKPYVCQICGKAFSQSCNLVNHTRIHSGEKPFKCPHCDKAFTQSGNLNNHIRLHTNEKPFKCHFCDKAFVQSGNLNSHIMNNHRSREFPSYLEPSLSESISNQTI
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00020775;
- 90% Identity
- iTF_00020775;
- 80% Identity
- iTF_00020775;