Adec027873.1
Basic Information
- Insect
- Adalia decempunctata
- Gene Symbol
- Ssb-c31a
- Assembly
- GCA_951802165.1
- Location
- OX637700.1:38205364-38205739[+]
Transcription Factor Domain
- TF Family
- PC4
- Domain
- PC4 domain
- PFAM
- PF02229
- TF Group
- Unclassified Structure
- Description
- This domain is found at the C-terminal end of Activated RNA polymerase II transcriptional coactivator p15 from humans, YdbC from Lactococcus lactis, and other PC4 family members. p15 has a bipartite structure composed of an N-terminal regulatory domain and a carboxy-terminal cryptic DNA-binding domain [1-4]. Activity is controlled by protein kinases that target the regulatory domain.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 9.4e-30 4e-25 88.3 2.1 1 50 43 92 43 94 0.98
Sequence Information
- Coding Sequence
- ATGCCGAAGAACAAGAAGGACGATATTTCATCAGACTCCGATTCTGGCCCTGATGATAGAACTCCTCCAAGTAAGAAGCAGAAAGTCGTACAAAAAAGCAAACCGTCATCTGAGGAAGAAAACTCATGGGATCTGGGTAAAAATCGCTTCGTAAAGCTTTCtgaattcaaaggaaaatggTATGTGAATATCAGGGAGTTTTATGAAAAGGACGGAGAAATGAGACCTGGAAAGAAAGGCATCATGTTGACCATGGAGCAGTGGCAAAAATTCAAGGGACTTGTTAGTGAAGTAGATGAAGCTATTAAGAAGAATGTTTGA
- Protein Sequence
- MPKNKKDDISSDSDSGPDDRTPPSKKQKVVQKSKPSSEEENSWDLGKNRFVKLSEFKGKWYVNIREFYEKDGEMRPGKKGIMLTMEQWQKFKGLVSEVDEAIKKNV
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -