Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 4 2e+03 -1.1 0.0 27 43 8 24 6 29 0.86

2 7 0.022 11 6.1 0.0 20 44 29 53 21 62 0.83

3 7 0.21 1.1e+02 3.0 0.0 21 44 58 81 53 89 0.83

4 7 0.18 92 3.2 0.0 20 43 85 108 78 113 0.82

5 7 0.038 19 5.4 0.1 20 43 113 136 106 141 0.85

6 7 0.84 4.3e+02 1.1 0.1 21 43 142 164 137 170 0.83

7 7 0.039 20 5.3 0.0 20 43 169 192 162 199 0.82

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	4	2e+03	-1.1	0.0	27	43	8	24	6	29	0.86
2	7	0.022	11	6.1	0.0	20	44	29	53	21	62	0.83
3	7	0.21	1.1e+02	3.0	0.0	21	44	58	81	53	89	0.83
4	7	0.18	92	3.2	0.0	20	43	85	108	78	113	0.82
5	7	0.038	19	5.4	0.1	20	43	113	136	106	141	0.85
6	7	0.84	4.3e+02	1.1	0.1	21	43	142	164	137	170	0.83
7	7	0.039	20	5.3	0.0	20	43	169	192	162	199	0.82

Coding Sequence: ATGGAGAAGAAACTTTATCAGTGCGATGTCTGCGACAAGTCGTTCGGCCAAAATAGCAATTTGACAAcacatcgacgcacgcacacaggcgaaaaaccgtacgcgtgcgatgtatgcgaaaagtcgtTCTCTCAAAGTGGCCATTTGAAGGGACACAAGCGGACTCACACcggagaaaaaccgtacgcgtgtgatgtatgcgaaaagtcgtTCTCTGAAAGTGGCAAGTTGACGAAACACAAGCGGAcccacactggagaaaaaccgtacgcgtgcgatgtatgcgaaATGTCGTTCTCTGAAAGTGGCAGTTTGACGAAACACAAGCGGACTCACACcggagaaaaaccgtacgcgtgtgatgtatgcgaaaagtcgtTCTCTGCAAGTAACAATTTGACAAcacatcgacgcacacacactggagaaaaatcgtacgcgtgtgatgtatgcgaaaagtcgtTCTCTGCAAGTAGCAATTTGACAAcacatcgacgcacacacactggagAAAAGCCGTACGCTTGCGATGTATGCGAGAAGTCGTTCTCTAAAAGTGGCAATTTGACAATACACAAGCGTACGCACATGGCACACTGA
Protein Sequence: MEKKLYQCDVCDKSFGQNSNLTTHRRTHTGEKPYACDVCEKSFSQSGHLKGHKRTHTGEKPYACDVCEKSFSESGKLTKHKRTHTGEKPYACDVCEMSFSESGSLTKHKRTHTGEKPYACDVCEKSFSASNNLTTHRRTHTGEKSYACDVCEKSFSASSNLTTHRRTHTGEKPYACDVCEKSFSKSGNLTIHKRTHMAH

Sequence clustering based on sequence similarity using MMseqs2