Basic Information

Gene Symbol
ZSCAN16_12
Assembly
GCA_005508785.1
Location
NC:122695443-122696589[+]

Transcription Factor Domain

TF Family
zf-GAGA
Domain
zf-GAGA domain
PFAM
PF09237
TF Group
Zinc-Coordinating Group
Description
Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 10 0.31 1.6e+02 2.4 0.0 26 44 7 25 3 33 0.85
2 10 0.11 57 3.8 0.0 21 44 30 53 25 62 0.84
3 10 1.8 9.3e+02 -0.0 0.1 20 43 57 80 51 89 0.76
4 10 1.7 8.7e+02 0.1 0.0 20 43 85 108 75 112 0.77
5 10 0.00023 0.12 12.4 0.1 20 45 113 138 102 147 0.84
6 10 0.73 3.7e+02 1.3 0.1 21 43 142 164 137 173 0.78
7 10 0.039 20 5.3 0.1 20 44 169 193 159 202 0.83
8 10 0.9 4.6e+02 1.0 0.0 21 43 198 220 193 229 0.79
9 10 0.77 3.9e+02 1.2 0.1 20 43 225 248 218 252 0.76
10 10 0.0037 1.9 8.6 0.1 20 44 253 277 246 283 0.82

Sequence Information

Coding Sequence
ATGGAGAAGAAACGTCATCAGTGCGATGTCTGCGACAAGTCGTTCAGCCAAAGTAGCAGTTTGACGAGACACAAGCGGACTCACACAggcgaaaaaccgtacgcgtgcgatgtatgcgaaaagtcgtTCTCACAAAGTGGCCATTTGACAGCACATCGACGCACCCACACAGGCGAAAAACCGTACccgtgcgatgtatgcgacatgTCGTTCTCCGAAAGTGGCAGTTTGACAGtacatcgacgcacgcacacaGGCGAAAAACCGTACccgtgcgatgtatgcgacatgTCGTTCTCCGAAAGTGGCAGTTTGACAGCACACCGACGCACGCACACAggcgaaaaaccgtacgcgtgcgatgtatgcgacatgTCGTTCAGCCAAAGTAGCAATTTGACGAGACACAGGCGGACTCACACCGGAGAAAAACCTTACGCGTGCGATGTGTGCGACATGTCGTTCTCCGAAAGTGGCAGTTTGACAGCACACCGACGCACGCACACCggcgaaaaaccgtacgcgtgcgaCGTATGCGAAAAGTCGTTCTCTAACAGTGACCATTTGACGAGACACAAGCGGACTCACACcggagaaaaaccgtacgcgtgcgatgtatgcgaaaagtcgtTCTCCGAAAGTGGCAGTTTGACAGCACACCGGCGCACGCACACCggcgaaaaaccgtacgcgtgcgatgtatgcgaaaagtcgtTCTCCGAAAGTGGCAGTTTGACAGCACACCGACGCACGCACACAggcgaaaaaccgtacgcgtgcgatgtatgcgaaaagtcgtTCTCTCAATTCACCAATTTGACAAGACACAAGCGTAAGCACATGGCACACTGA
Protein Sequence
MEKKRHQCDVCDKSFSQSSSLTRHKRTHTGEKPYACDVCEKSFSQSGHLTAHRRTHTGEKPYPCDVCDMSFSESGSLTVHRRTHTGEKPYPCDVCDMSFSESGSLTAHRRTHTGEKPYACDVCDMSFSQSSNLTRHRRTHTGEKPYACDVCDMSFSESGSLTAHRRTHTGEKPYACDVCEKSFSNSDHLTRHKRTHTGEKPYACDVCEKSFSESGSLTAHRRTHTGEKPYACDVCEKSFSESGSLTAHRRTHTGEKPYACDVCEKSFSQFTNLTRHKRKHMAH

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity
iTF_00019536;
90% Identity
iTF_00019536;
80% Identity
iTF_00019536;