Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 0.31 1.6e+02 2.4 0.0 26 44 7 25 3 33 0.85

2 10 0.11 57 3.8 0.0 21 44 30 53 25 62 0.84

3 10 1.8 9.3e+02 -0.0 0.1 20 43 57 80 51 89 0.76

4 10 1.7 8.7e+02 0.1 0.0 20 43 85 108 75 112 0.77

5 10 0.00023 0.12 12.4 0.1 20 45 113 138 102 147 0.84

6 10 0.73 3.7e+02 1.3 0.1 21 43 142 164 137 173 0.78

7 10 0.039 20 5.3 0.1 20 44 169 193 159 202 0.83

8 10 0.9 4.6e+02 1.0 0.0 21 43 198 220 193 229 0.79

9 10 0.77 3.9e+02 1.2 0.1 20 43 225 248 218 252 0.76

10 10 0.0037 1.9 8.6 0.1 20 44 253 277 246 283 0.82

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	0.31	1.6e+02	2.4	0.0	26	44	7	25	3	33	0.85
2	10	0.11	57	3.8	0.0	21	44	30	53	25	62	0.84
3	10	1.8	9.3e+02	-0.0	0.1	20	43	57	80	51	89	0.76
4	10	1.7	8.7e+02	0.1	0.0	20	43	85	108	75	112	0.77
5	10	0.00023	0.12	12.4	0.1	20	45	113	138	102	147	0.84
6	10	0.73	3.7e+02	1.3	0.1	21	43	142	164	137	173	0.78
7	10	0.039	20	5.3	0.1	20	44	169	193	159	202	0.83
8	10	0.9	4.6e+02	1.0	0.0	21	43	198	220	193	229	0.79
9	10	0.77	3.9e+02	1.2	0.1	20	43	225	248	218	252	0.76
10	10	0.0037	1.9	8.6	0.1	20	44	253	277	246	283	0.82

Coding Sequence: ATGGAGAAGAAACGTCATCAGTGCGATGTCTGCGACAAGTCGTTCAGCCAAAGTAGCAGTTTGACGAGACACAAGCGGACTCACACAggcgaaaaaccgtacgcgtgcgatgtatgcgaaaagtcgtTCTCACAAAGTGGCCATTTGACAGCACATCGACGCACCCACACAGGCGAAAAACCGTACccgtgcgatgtatgcgacatgTCGTTCTCCGAAAGTGGCAGTTTGACAGtacatcgacgcacgcacacaGGCGAAAAACCGTACccgtgcgatgtatgcgacatgTCGTTCTCCGAAAGTGGCAGTTTGACAGCACACCGACGCACGCACACAggcgaaaaaccgtacgcgtgcgatgtatgcgacatgTCGTTCAGCCAAAGTAGCAATTTGACGAGACACAGGCGGACTCACACCGGAGAAAAACCTTACGCGTGCGATGTGTGCGACATGTCGTTCTCCGAAAGTGGCAGTTTGACAGCACACCGACGCACGCACACCggcgaaaaaccgtacgcgtgcgaCGTATGCGAAAAGTCGTTCTCTAACAGTGACCATTTGACGAGACACAAGCGGACTCACACcggagaaaaaccgtacgcgtgcgatgtatgcgaaaagtcgtTCTCCGAAAGTGGCAGTTTGACAGCACACCGGCGCACGCACACCggcgaaaaaccgtacgcgtgcgatgtatgcgaaaagtcgtTCTCCGAAAGTGGCAGTTTGACAGCACACCGACGCACGCACACAggcgaaaaaccgtacgcgtgcgatgtatgcgaaaagtcgtTCTCTCAATTCACCAATTTGACAAGACACAAGCGTAAGCACATGGCACACTGA
Protein Sequence: MEKKRHQCDVCDKSFSQSSSLTRHKRTHTGEKPYACDVCEKSFSQSGHLTAHRRTHTGEKPYPCDVCDMSFSESGSLTVHRRTHTGEKPYPCDVCDMSFSESGSLTAHRRTHTGEKPYACDVCDMSFSQSSNLTRHRRTHTGEKPYACDVCDMSFSESGSLTAHRRTHTGEKPYACDVCEKSFSNSDHLTRHKRTHTGEKPYACDVCEKSFSESGSLTAHRRTHTGEKPYACDVCEKSFSESGSLTAHRRTHTGEKPYACDVCEKSFSQFTNLTRHKRKHMAH

Sequence clustering based on sequence similarity using MMseqs2