Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 0.0015 0.74 9.9 0.3 14 43 11 40 5 46 0.88

2 9 0.69 3.5e+02 1.3 0.1 20 41 73 94 65 107 0.75

3 9 4.6 2.3e+03 -1.3 0.0 21 41 102 122 96 130 0.73

4 9 0.0036 1.8 8.6 0.2 20 44 129 153 116 162 0.82

5 9 1.6 7.9e+02 0.2 0.1 21 43 158 180 153 184 0.76

6 9 0.076 38 4.4 0.0 21 43 186 208 176 213 0.88

7 9 0.021 11 6.2 0.1 17 43 238 264 222 269 0.80

8 9 0.0078 4 7.6 0.1 21 43 270 292 265 296 0.89

9 9 0.74 3.8e+02 1.2 0.1 21 31 298 308 293 309 0.82

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	0.0015	0.74	9.9	0.3	14	43	11	40	5	46	0.88
2	9	0.69	3.5e+02	1.3	0.1	20	41	73	94	65	107	0.75
3	9	4.6	2.3e+03	-1.3	0.0	21	41	102	122	96	130	0.73
4	9	0.0036	1.8	8.6	0.2	20	44	129	153	116	162	0.82
5	9	1.6	7.9e+02	0.2	0.1	21	43	158	180	153	184	0.76
6	9	0.076	38	4.4	0.0	21	43	186	208	176	213	0.88
7	9	0.021	11	6.2	0.1	17	43	238	264	222	269	0.80
8	9	0.0078	4	7.6	0.1	21	43	270	292	265	296	0.89
9	9	0.74	3.8e+02	1.2	0.1	21	31	298	308	293	309	0.82

Coding Sequence: ATGTCGTTCAGTCAAAGTTGTAATTTGACAAAACATCGACGGACCCACACTGGCGAGAAGCCTTTTgcatgcgatgtatgcgacatgTCGTTCAGTCAAAGTTGTAATTTGACAAAACATCGACGGACccacactggtgaaaaactATACGCATGCGATGTATGTGACAAATCGTTTGCTACAAGTTATACTTTGACGATTCACCATCGGAGTCACACGGGCGAGAAACCATAcgcatgcgatgtatgcgacaaaTCGTTTGCTACAAGTAGCACATTGATGTGTCATCGTCGGACTCACACGGGTGAGAAGACTTTTGCGTGCGATATATGTGATAAATCGTTTGCTAAAAGTTACACTTTGACGATTCACCATCGGAGTCACACGGGTGAGAAACCATACTcatgcgatgtatgcgacatgTCGTTCAGTCAAAGTTGTCATTTGACAAGACATCAACGGACCCACACTGGTGAGAAACCATTTGCGTGCGATGTATGTGACAAATCGTTTGCTACTAGTTACACTTTGACGAGTCACCATAGGACTCACACGGGCGAGAAACCATAcgcatgcgatgtatgcgacaaaTCGTTTACTGAAAGTAGCACATTGACAAGACATCGACGGACCCACACTGGCGAGAAACTATACGCATGCGATGTATGCAACAAGGCGTTTTTTGATAGTGGCACATTGACGAATCACCGTCGGACTCACACGGGCGAGAAACCATACGCATGCGATGTATGTGAAAAGACGTTTACTGAAAGTAGCACATTGACAAGACATCGACGGACTCACACGGGCGAGAAACCATACGCATGTGATGTATGTAACATGTCGTTCAGTCAAAGTGGTCATTTGACAAGACATCGACGGACCCACACTGGTGAGAAACCATTTACGTGCGATCTATGCCATAAGTAA
Protein Sequence: MSFSQSCNLTKHRRTHTGEKPFACDVCDMSFSQSCNLTKHRRTHTGEKLYACDVCDKSFATSYTLTIHHRSHTGEKPYACDVCDKSFATSSTLMCHRRTHTGEKTFACDICDKSFAKSYTLTIHHRSHTGEKPYSCDVCDMSFSQSCHLTRHQRTHTGEKPFACDVCDKSFATSYTLTSHHRTHTGEKPYACDVCDKSFTESSTLTRHRRTHTGEKLYACDVCNKAFFDSGTLTNHRRTHTGEKPYACDVCEKTFTESSTLTRHRRTHTGEKPYACDVCNMSFSQSGHLTRHRRTHTGEKPFTCDLCHK

Sequence clustering based on sequence similarity using MMseqs2