Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.58 3e+02 1.6 0.0 26 43 7 24 3 28 0.88

2 6 0.0034 1.7 8.7 0.1 14 44 23 53 20 61 0.84

3 6 0.011 5.4 7.1 0.1 15 43 52 80 50 85 0.86

4 6 0.039 20 5.3 0.1 15 44 80 109 78 117 0.82

5 6 0.055 28 4.9 0.0 15 43 108 136 106 141 0.82

6 6 0.086 44 4.2 0.0 20 43 141 164 135 170 0.82

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.58	3e+02	1.6	0.0	26	43	7	24	3	28	0.88
2	6	0.0034	1.7	8.7	0.1	14	44	23	53	20	61	0.84
3	6	0.011	5.4	7.1	0.1	15	43	52	80	50	85	0.86
4	6	0.039	20	5.3	0.1	15	44	80	109	78	117	0.82
5	6	0.055	28	4.9	0.0	15	43	108	136	106	141	0.82
6	6	0.086	44	4.2	0.0	20	43	141	164	135	170	0.82

Coding Sequence: ATGGAGAATAAGTCTTACAAGTGCGATGTATGTGACATGTTGTTCTTTGAAAGTAACAATTTGACGAaacatcgacgcacacacactggtgaaaaaccgtacgcctgcgatgtatgcgaaaagtcgtTCTCTCAAAGCAACAGTTTGACAAaacatcgacgcacacacactggtgaaaaaccgtacgcctgcgatgtatgcgacaagtcgttctctCAAAGTGGCCATTTGACGAaacatcgacgcacacacactggtgaaaaaccgtacgcctgcgatgtatgcgacaagtcgttctctGAAAGCAACAGTTTGACAAaacatcgacgcacacacactggtgaaaaaccgcACGCctgcgatgtatgcgacaagtcgttctctGTAAGTGGCAATTTGATAAcacatcgacgcacacacactggtgaaaaaccgtacgcctgcgatgtatgcgacaagtcgttctctATAAGTAGCAATTTGATGGTACACAAGCTGACGCACATGGAAAACTGA
Protein Sequence: MENKSYKCDVCDMLFFESNNLTKHRRTHTGEKPYACDVCEKSFSQSNSLTKHRRTHTGEKPYACDVCDKSFSQSGHLTKHRRTHTGEKPYACDVCDKSFSESNSLTKHRRTHTGEKPHACDVCDKSFSVSGNLITHRRTHTGEKPYACDVCDKSFSISSNLMVHKLTHMEN

Sequence clustering based on sequence similarity using MMseqs2