Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.4 2e+02 2.1 0.0 27 43 8 24 4 33 0.87

2 7 0.0067 3.4 7.8 0.0 16 44 53 81 45 89 0.82

3 7 0.47 2.4e+02 1.8 0.1 16 43 81 108 79 112 0.73

4 7 0.053 27 4.9 0.0 21 43 114 136 103 140 0.87

5 7 0.018 9.1 6.4 0.1 20 44 141 165 134 173 0.84

6 7 0.058 30 4.8 0.1 15 43 164 192 162 201 0.79

7 7 0.14 69 3.6 0.0 19 43 196 220 184 224 0.73

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.4	2e+02	2.1	0.0	27	43	8	24	4	33	0.87
2	7	0.0067	3.4	7.8	0.0	16	44	53	81	45	89	0.82
3	7	0.47	2.4e+02	1.8	0.1	16	43	81	108	79	112	0.73
4	7	0.053	27	4.9	0.0	21	43	114	136	103	140	0.87
5	7	0.018	9.1	6.4	0.1	20	44	141	165	134	173	0.84
6	7	0.058	30	4.8	0.1	15	43	164	192	162	201	0.79
7	7	0.14	69	3.6	0.0	19	43	196	220	184	224	0.73

Coding Sequence: ATGGACAAGAAACTTTACCCGTGTGATGTATGTGAAAAGTCGTTCAGCCAAAGTAGCAATTTGACGACACATCAACGAGCATACACTGGTGGAAAACCATACGCATGCAGTGTATACGACAAGTCATTCAATGAAAGTGGCACATTCATAAAACATCGACGAACACACACTGGCAAAAAACCGTACGAGTGCAATGTATGCGAAAAGGTGTTCAGTAATAGTGGCAATTTGATGAAACATCGGCGCacacacactggtgaaaaaccgtacgcgtgtgatgtatgcgacaagtcgttctctGAAAATGGCGCATTAACAAAACATATTCGCACgcacactggcgaaaaaccgtatgcgtgcgatgtatgcgatAAAACGTTCAGTAATAGTGGCAATTTGACGACGCATCGACGAacacacactggtgaaaaacctTACGCATGTGATGTGTGCGAAAAGGCGTTTTCTGTAAGTAGCAATTTGACAAAACATCGACGAacacacactggtgaaaaaccgtacgcTTGCGATATATGTGACAAGTTTTTTGCTAAAAGTGGCACATTAACGAGTCATCGACGAACccacactggtgaaaaaccgtacgcatgcgatatatgcgacaagtcgttcagTGAAAGTTTCACATTGACGACACATCGACGCACACATACTGGTGAATAA
Protein Sequence: MDKKLYPCDVCEKSFSQSSNLTTHQRAYTGGKPYACSVYDKSFNESGTFIKHRRTHTGKKPYECNVCEKVFSNSGNLMKHRRTHTGEKPYACDVCDKSFSENGALTKHIRTHTGEKPYACDVCDKTFSNSGNLTTHRRTHTGEKPYACDVCEKAFSVSSNLTKHRRTHTGEKPYACDICDKFFAKSGTLTSHRRTHTGEKPYACDICDKSFSESFTLTTHRRTHTGE

Sequence clustering based on sequence similarity using MMseqs2