Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 12 0.073 37 4.5 0.0 25 44 6 25 2 30 0.85

2 12 0.014 7.2 6.7 0.1 21 44 30 53 25 61 0.86

3 12 0.47 2.4e+02 1.9 0.1 21 43 58 80 53 84 0.86

4 12 0.0073 3.7 7.7 0.1 21 44 86 109 78 118 0.84

5 12 9.2 4.7e+03 -2.3 0.1 21 31 114 124 110 138 0.76

6 12 0.11 57 3.8 0.1 20 43 141 164 132 169 0.84

7 12 0.012 6.3 6.9 0.1 21 44 170 193 162 202 0.84

8 12 2.9 1.5e+03 -0.7 0.2 21 31 198 208 191 222 0.76

9 12 0.066 34 4.6 0.0 20 44 225 249 216 257 0.83

10 12 0.59 3e+02 1.5 0.1 22 44 255 277 249 285 0.84

11 12 0.83 4.2e+02 1.1 0.2 19 43 280 304 273 308 0.75

12 12 0.013 6.5 6.9 0.1 19 43 308 332 300 336 0.86

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	12	0.073	37	4.5	0.0	25	44	6	25	2	30	0.85
2	12	0.014	7.2	6.7	0.1	21	44	30	53	25	61	0.86
3	12	0.47	2.4e+02	1.9	0.1	21	43	58	80	53	84	0.86
4	12	0.0073	3.7	7.7	0.1	21	44	86	109	78	118	0.84
5	12	9.2	4.7e+03	-2.3	0.1	21	31	114	124	110	138	0.76
6	12	0.11	57	3.8	0.1	20	43	141	164	132	169	0.84
7	12	0.012	6.3	6.9	0.1	21	44	170	193	162	202	0.84
8	12	2.9	1.5e+03	-0.7	0.2	21	31	198	208	191	222	0.76
9	12	0.066	34	4.6	0.0	20	44	225	249	216	257	0.83
10	12	0.59	3e+02	1.5	0.1	22	44	255	277	249	285	0.84
11	12	0.83	4.2e+02	1.1	0.2	19	43	280	304	273	308	0.75
12	12	0.013	6.5	6.9	0.1	19	43	308	332	300	336	0.86

Coding Sequence: ATGGAGAAGAAATCATTAACATGCGAAGTCTATGACAAGTCATTCCGCCAAAGTAACAATTTGAAGAACCATCAACAAAAACACACAGGTGAAAAACCTTACCCATGCGATGTATGCAACAAGTCTTTCAGTCAAAGTAGCAATTTAATGAGCCATCAACGTacacacactggtgaaaaaccgtacccatgtgatgtatgcgacaagtcgttcagCCAAAGTAGCGGTTTGACGAGCCATCAACGCACACACACCGGTGAAAAACCAtacgcgtgcgatgtatgcgacaagtcTTTCAGTCAAAGTAGCAATTTAATGAGCCATCAACGTacacacactggtgaaaaaccgtacccatgtgatgtatgcgacaagtcgtttgCTGAAAATAGTCATTTGACAACGCATCGACGCACACATACtggcgaaaaaccgtacgcgtgcgatgtatgcgacaagtcgttcagCCAAAGTAGCGTTTTGACGAACCATCAACGCacacacactggtgaaaaaccatacgcgtgcgatgtatgtGACAAGTCTTTCAGTCAAAGTATCAATTTAATGAGCCATCAACGCACACATactggtgaaaaaccgtacCCATGTGAtatatgcgacaagtcgtttTCTGAAAATAGTCATTTGACAACGCATCGACGCACACATACtggcgaaaaaccgtacgcgtgcgatgtatgcgacaagtcgttcagCCAAAGTAGCGGTTTGACGAACCATCAACGCACACACACTGGTGATAAGCcgtacgcgtgcgatgtatgcgacaagtcaTTCTCTGTAAGTAGTCATTTGACGAGACATCGACGTACACACACTGGTGAGAAACCGTACGCGTGCCATGTATGTGACAAGTCTTTCTCTACAAGTGGCGAATTGACAAAccatcgacgcacacacactggtgAGAAACCGTACGCGTGCCATGTATGTGACAAGTCTTTCTCTGCAAGTGGCAATTTGACAAGACATCGACGCAAACACACTGGTGAATAA
Protein Sequence: MEKKSLTCEVYDKSFRQSNNLKNHQQKHTGEKPYPCDVCNKSFSQSSNLMSHQRTHTGEKPYPCDVCDKSFSQSSGLTSHQRTHTGEKPYACDVCDKSFSQSSNLMSHQRTHTGEKPYPCDVCDKSFAENSHLTTHRRTHTGEKPYACDVCDKSFSQSSVLTNHQRTHTGEKPYACDVCDKSFSQSINLMSHQRTHTGEKPYPCDICDKSFSENSHLTTHRRTHTGEKPYACDVCDKSFSQSSGLTNHQRTHTGDKPYACDVCDKSFSVSSHLTRHRRTHTGEKPYACHVCDKSFSTSGELTNHRRTHTGEKPYACHVCDKSFSASGNLTRHRRKHTGE

Sequence clustering based on sequence similarity using MMseqs2