Apis001600.1
Basic Information
- Insect
- Acyrthosiphon pisum
- Gene Symbol
- -
- Assembly
- GCA_005508785.1
- Location
- NC:89931402-89934054[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 6 2.1 1.1e+03 -0.3 0.0 27 44 8 25 4 33 0.82 2 6 0.0029 1.5 8.9 0.1 19 43 28 52 22 57 0.85 3 6 0.0022 1.1 9.3 0.1 21 43 58 80 53 85 0.87 4 6 0.0016 0.79 9.8 0.1 19 43 84 108 78 112 0.85 5 6 0.0064 3.3 7.8 0.0 20 44 113 137 108 145 0.84 6 6 0.13 64 3.7 0.3 20 44 141 165 135 172 0.78
Sequence Information
- Coding Sequence
- ATGGAGAAGAAATCTTACCCATGCGATGTTTGTGACAAGTCGTTTAACCGAAGTGGAAATTTGACGAAtcatcgacgcacgcacactggcgaaaaaccatacacgtgtgatgtatgcgacaagtcgttcagCCGAAGTAGCAATTTGACGAAtcatcgacgcacgcacaccGGCGAAAAACCATACacgtgcgatgtatgcgacaagtcgttcagCCAAAGTAGCCATTTGAAGAAtcatcgacgcacgcacaccggcgaaaaaccgtacacgtgcgatgtatgcgacaagtcgttcagCCAAAGTAGCCATTTGAAGAAtcatcgacgcacgcacaccGGCGAAAAACCGTACACGTGCGATGTATGTGACAAGTCGTTCAGTGAAAGTGGCCATTTGATGAGacatcgacgcacgcacactggcgaaaaaccatacgcgtgtgatgtatgcgacaagtcgtttAACCAAAATAGCCATTTGATGACACATCGACGCACACATTTCtctgaaaattgtaatttgatgGTACACAAGCGGACGCATATAGCACACTGA
- Protein Sequence
- MEKKSYPCDVCDKSFNRSGNLTNHRRTHTGEKPYTCDVCDKSFSRSSNLTNHRRTHTGEKPYTCDVCDKSFSQSSHLKNHRRTHTGEKPYTCDVCDKSFSQSSHLKNHRRTHTGEKPYTCDVCDKSFSESGHLMRHRRTHTGEKPYACDVCDKSFNQNSHLMTHRRTHFSENCNLMVHKRTHIAH
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00019575;
- 90% Identity
- iTF_00019575;
- 80% Identity
- iTF_00019575;