Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.26 1.3e+02 2.7 0.0 27 44 8 25 4 33 0.85

2 8 0.31 1.6e+02 2.4 0.3 21 43 30 52 23 56 0.85

3 8 5e-05 0.026 14.6 0.1 20 43 57 80 50 85 0.86

4 8 0.092 47 4.1 0.0 21 43 86 108 81 113 0.89

5 8 0.046 23 5.1 0.0 20 43 113 136 108 141 0.86

6 8 0.0022 1.1 9.3 0.0 20 44 141 165 135 173 0.85

7 8 0.15 75 3.5 0.1 19 43 168 192 165 197 0.84

8 8 0.00034 0.17 11.9 0.4 21 45 198 222 191 231 0.84

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.26	1.3e+02	2.7	0.0	27	44	8	25	4	33	0.85
2	8	0.31	1.6e+02	2.4	0.3	21	43	30	52	23	56	0.85
3	8	5e-05	0.026	14.6	0.1	20	43	57	80	50	85	0.86
4	8	0.092	47	4.1	0.0	21	43	86	108	81	113	0.89
5	8	0.046	23	5.1	0.0	20	43	113	136	108	141	0.86
6	8	0.0022	1.1	9.3	0.0	20	44	141	165	135	173	0.85
7	8	0.15	75	3.5	0.1	19	43	168	192	165	197	0.84
8	8	0.00034	0.17	11.9	0.4	21	45	198	222	191	231	0.84

Coding Sequence: ATGGAGAAGAAACTTTATCAGTGTGATGTCTGCGACAAGTCGTTCAGCCAAAGTAACAATTTGACGACACACAAGCGGacgcacactggagaaaaaccgtacgcgtgcgatgtatgcgaaATGTCGTTCTCTGTAAGTTGTGTTTTGACGAGACATCGACGCACGCATGTTGGAGAAAAACCGTACacgtgcgatgtatgcgacatgTCGTTCAGCCAAAGTAGCAATTTGACGAGACACAAGCGGacgcacactggagaaaaaccgtacgcgtgcgatgtatgcgacatgTCGTTCTCCGAAAGTGGCGCTTTGACGAGACATCGACGCACGCatactggagaaaaaccgtacgcgtgcgatgtatgtGAAATGTCGTTCTCTAAAAGTGGCAATTTGACAACACATCGTCGCACGCACgctggagaaaaaccgtacgcgtgcgatgtatgtGAAATGTCGTTCTCTAAAAGTGACAATTTGACGAGACATCGACGCAAGCatactggagaaaaaccgtacgcgtgcgatgtatgtGAAATGTCGTTCTCTGTAAGTTTTGCTTTGACGAGACATCGACGCACGCACATTGGAGAAAAACCGTACacgtgcgatgtatgcgacatgTCGTTCAGCCAATGTAGCAATTTGACGAGACACAAGCGGacgcacactggagaaaaaccgtacgcgtgcgaTGTACCTATGCGAGAAGTCGTTCTCTGA
Protein Sequence: MEKKLYQCDVCDKSFSQSNNLTTHKRTHTGEKPYACDVCEMSFSVSCVLTRHRRTHVGEKPYTCDVCDMSFSQSSNLTRHKRTHTGEKPYACDVCDMSFSESGALTRHRRTHTGEKPYACDVCEMSFSKSGNLTTHRRTHAGEKPYACDVCEMSFSKSDNLTRHRRKHTGEKPYACDVCEMSFSVSFALTRHRRTHIGEKPYTCDVCDMSFSQCSNLTRHKRTHTGEKPYACDVPMREVVL

Sequence clustering based on sequence similarity using MMseqs2