Ains005916.1
Basic Information
- Insect
- Acromyrmex insinuator
- Gene Symbol
- HMG20A
- Assembly
- GCA_017607455.1
- Location
- JAANHZ010000474.1:128225-130018[-]
Transcription Factor Domain
- TF Family
- HMG
- Domain
- HMG_box domain
- PFAM
- PF00505
- TF Group
- Other Alpha-Helix Group
- Description
- High mobility group (HMG) box domains are involved in binding DNA, and may be involved in protein-protein interactions as well. The structure of the HMG-box domain consists of three helices in an irregular array. HMG-box domains are found in one or more copies in HMG-box proteins, which form a large, diverse family involved in the regulation of DNA-dependent processes such as transcription, replication, and strand repair, all of which require the bending and unwinding of chromatin. Many of these proteins are regulators of gene expression. HMG-box proteins are found in a variety of eukaryotic organisms, and can be broadly divided into two groups, based on sequence-dependent and sequence-independent DNA recognition; the former usually contain one HMG-box motif, while the latter can contain multiple HMG-box motifs. HMG-box domains can be found in single or multiple copies in the following protein classes: HMG1 and HMG2 non-histone components of chromatin; SRY (sex determining region Y protein) involved in differential gonadogenesis; the SOX family of transcription factors [1]; sequence-specific LEF1 (lymphoid enhancer binding factor 1) and TCF-1 (T-cell factor 1) involved in regulation of organogenesis and thymocyte differentiation [2]; structure-specific recognition protein SSRP involved in transcription and replication; MTF1 mitochondrial transcription factor; nucleolar transcription factors UBF 1/2 (upstream binding factor) involved in transcription by RNA polymerase I; Abf2 yeast ARS-binding factor [3]; yeast transcription factors lxr1, Rox1, Nhp6b and Spp41; mating type proteins (MAT) involved in the sexual reproduction of fungi [4]; and the YABBY plant-specific transcription factors.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 2e-21 7.3e-19 67.0 0.3 1 69 77 145 77 145 0.98
Sequence Information
- Coding Sequence
- ATGAGTGAGATTACTCCAATGAATGATGTACCTGAGAGCAATGGTACGATGGAGCAGCCTGCTTATAATGGTGAAATAGAGGAACACGCTGCCAAATCTCCAGTAAGTACAGAAGAGAAAGCACCAGATTCAGTATGCGATAATGGTGTAAAGAGAAGTGCCACCGCCACTGGTAATACGCCAAATAGAACGAAGAAACGTAAAAAAGCCCCGAGAGACGCCACTGCGCCAAGACAGCCTCTGAGTGGTTACTTTCTGTTTTTAAACGATCGGAGAGAGAAAGTTCGAAATCAGAATCCAAGTTTAACGTTCACAGAAATCACGAAGCTTCTGGCTGCAGAATGGAGTAAATTGCCAATTGATCAGAAGCAGCGTTATTTGGATGCAGCTGAACAAGACAAAGAGCGCTACAATCGCGAGTTTAGTGATTATAAGCAAACAGAAGCATACAGAATGTACGatgatattactatatttaagATTGATAAGGACAATGACTTTACAGGCTTTGACATCCCTATTTTTACAGAAGAATTTCTAGATCATAACAAAGCTTGTGAGGCTGAATTAAGACAATTGCGAAAAGCTACATCTGACTACGAAGCTCAGAATGCGGTTCTTCAGCGACACGTGGACAGTCTGCACGCAGCGGTGAATCGCTTGGAGTCCGAAACTAATCAACAACGAACGACTAATCAAGCTCTGCAGCGTCATTTGGATTCTCTTCGTTCTCAATTAGCAGGCTGCTTCGCCACTATACCGCTTCCAACACATGACGGTGCTACGTTACAAAATATCGACAGTTATTTTGAGAGGCTGGAGTCTCTATTAAGCAGCAACGCTGAACAAAATCTACGTAACGCCGTACGTAGTGCTGTGTCTCGTCTCGAATTAGTTGGA
- Protein Sequence
- MSEITPMNDVPESNGTMEQPAYNGEIEEHAAKSPVSTEEKAPDSVCDNGVKRSATATGNTPNRTKKRKKAPRDATAPRQPLSGYFLFLNDRREKVRNQNPSLTFTEITKLLAAEWSKLPIDQKQRYLDAAEQDKERYNREFSDYKQTEAYRMYDDITIFKIDKDNDFTGFDIPIFTEEFLDHNKACEAELRQLRKATSDYEAQNAVLQRHVDSLHAAVNRLESETNQQRTTNQALQRHLDSLRSQLAGCFATIPLPTHDGATLQNIDSYFERLESLLSSNAEQNLRNAVRSAVSRLELVG
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01523332; iTF_00127426; iTF_00125895; iTF_00128172; iTF_00128944; iTF_00129713; iTF_00126683; iTF_00393569; iTF_00306237; iTF_01255520; iTF_00763201; iTF_00864610; iTF_00862534; iTF_00865287; iTF_00860360; iTF_00863244; iTF_00183918; iTF_00024592; iTF_00863924; iTF_00866676; iTF_00861846; iTF_00861111; iTF_01070999; iTF_00865977; iTF_00762522; iTF_00183260; iTF_00964449; iTF_00961795; iTF_00963823; iTF_00962481; iTF_00963161; iTF_00633604; iTF_01065540; iTF_01069640; iTF_01068268; iTF_01068946; iTF_01066227; iTF_01067583; iTF_01066912; iTF_01070336; iTF_01245189; iTF_00867367; iTF_00730028; iTF_00730708; iTF_00729270; iTF_00868765; iTF_00385286; iTF_01520200; iTF_00014694; iTF_00016014; iTF_01355281; iTF_01407249; iTF_01408177; iTF_01354580; iTF_01409082; iTF_00182589; iTF_00181279; iTF_00264969; iTF_00109794; iTF_01254765; iTF_00684138; iTF_01015786; iTF_00264238; iTF_00765550; iTF_00868078; iTF_00015346; iTF_01498195; iTF_00885078; iTF_01099158; iTF_01421526; iTF_01423630; iTF_01422896; iTF_00279929; iTF_01422201; iTF_00675994; iTF_01123034; iTF_01122406; iTF_00898715; iTF_01228990; iTF_01228344; iTF_00760959; iTF_00117980;
- 90% Identity
- iTF_00015346;
- 80% Identity
- -