Ater019887.1
Basic Information
- Insect
- Abscondita terminalis
- Gene Symbol
- -
- Assembly
- GCA_013368085.1
- Location
- JABVZW010003116.1:1687683-1688521[-]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 5 0.072 1.8e+02 2.5 0.1 26 43 112 130 106 136 0.74 2 5 0.086 2.2e+02 2.3 0.0 22 46 138 162 134 170 0.81 3 5 0.009 23 5.4 0.1 22 46 166 190 160 192 0.88 4 5 0.0001 0.26 11.6 0.1 21 52 193 224 189 224 0.88 5 5 0.0024 6.2 7.2 0.0 21 48 221 248 219 250 0.90
Sequence Information
- Coding Sequence
- ATGGAGCATGAGGACTCGGACGAAATTTTTCATTCATCTTTAGAGCCTGATGTTATTATAGATGATGCTTCCCATCCTGAAGATCACTACTACAATGATGaaggtaattttaaaatgcgcAATGAGGGTCGTAAAAGAACAAGTCCGATCATTACATTAACACCTATAACAAACGGAtctccaaatttaaaaatgtccaATGATGTAAATCTCGAAAGAAGGCCACGTAAAATACAAAGATCTCCAAGACAATCTGTAAGGCTGATACCTAAAGAAGAATTACTTCAAATAGATACTGATGCTTCCTTAAAAAGAAAATCTCTTCCTTTAGAAAAATGTCctatatgtaaaaaattctttcgaCGTATGAAAACGCATTTGCAAAAACACGAAAACATAAATCGTGATCCAAATGATCCTTTAACGTGCAAGTTTTGCATGAAAGCTTTTAATACCggtagtaatttaattatacacatgAGAACTCACACAGGCCATAAACCGTACATATGCGAAGTATGTACGAAAGGTTTTGCTCAATCCTGTAATTTAGTTAATCATATGCGTATTCACACTGGAGAAAGACCATTTAAGTGTCCACATTGCGATCGGGCGTTCACACAGTCTGGTAATCTAAGTAATCATGTTCGATTGCACACAGATGAAAAACCTTTCAAATgtcatttttgtgaaaaagcctTTACACAATCTGGTAATTTAAATTCTCATATAAGAaacaatcataaatttttaataaacggaAACGATTTAAACAACACCATACAGTag
- Protein Sequence
- MEHEDSDEIFHSSLEPDVIIDDASHPEDHYYNDEGNFKMRNEGRKRTSPIITLTPITNGSPNLKMSNDVNLERRPRKIQRSPRQSVRLIPKEELLQIDTDASLKRKSLPLEKCPICKKFFRRMKTHLQKHENINRDPNDPLTCKFCMKAFNTGSNLIIHMRTHTGHKPYICEVCTKGFAQSCNLVNHMRIHTGERPFKCPHCDRAFTQSGNLSNHVRLHTDEKPFKCHFCEKAFTQSGNLNSHIRNNHKFLINGNDLNNTIQ
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00003282; iTF_00004149;
- 90% Identity
- iTF_00003282; iTF_00004149;
- 80% Identity
- iTF_00004149;