Basic Information

Transcription Factor Domain

TF Family: zf-BED
Domain: zf-BED domain
PFAM: PF02892
TF Group: Zinc-Coordinating Group
Description: The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 3.4 6.2e+03 -3.0 12.0 17 38 14 57 1 62 0.63

2 8 0.0023 4.3 7.2 6.2 3 44 54 91 52 91 0.87

3 8 5.7e-06 0.01 15.5 1.9 19 41 108 128 101 130 0.93

4 8 0.04 74 3.2 5.8 15 43 137 162 129 163 0.85

5 8 0.061 1.1e+02 2.6 0.4 16 28 168 180 164 195 0.79

6 8 4e-05 0.073 12.8 2.8 17 41 197 218 181 220 0.88

7 8 0.00088 1.6 8.5 0.8 18 40 226 245 221 248 0.83

8 8 0.038 70 3.3 0.8 18 43 254 276 249 277 0.79

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	3.4	6.2e+03	-3.0	12.0	17	38	14	57	1	62	0.63
2	8	0.0023	4.3	7.2	6.2	3	44	54	91	52	91	0.87
3	8	5.7e-06	0.01	15.5	1.9	19	41	108	128	101	130	0.93
4	8	0.04	74	3.2	5.8	15	43	137	162	129	163	0.85
5	8	0.061	1.1e+02	2.6	0.4	16	28	168	180	164	195	0.79
6	8	4e-05	0.073	12.8	2.8	17	41	197	218	181	220	0.88
7	8	0.00088	1.6	8.5	0.8	18	40	226	245	221	248	0.83
8	8	0.038	70	3.3	0.8	18	43	254	276	249	277	0.79

Coding Sequence: ATGAAATCCCATTTAGTCTTGCATACCGATCATCGACTGCATTCGTGCGATAAATGCGGTAAAACGTTCAAACGAAAATATGAACGAGACCGACATGGATGTTATGATGATATGTTTGAATGTGATGTTTGCCATAGAAAATTGGGTAATTCgtacaatttgaaaaatcatcgTCGGCGACATTTCGATGATTATAAAGTTAAATGTGAAATATGTGGTAGTGGTTGTATGTCGGGAGCGGAATTACGTCAACATATCGATAGGAAACATAATAAGAATAGTGATAAATATAGGAATCGATCAGCTGATATTGTACATCTTTGCAATATTTGCGGTGTTTCATTAACTGGTGGTACAACATCATTGAAACATCATTTGAAACGACACGAAGCCAATTATAAGGAGAATCGtaattttaaatgtaaattttgtacGAAATCATTCATGCAAGaattacatttgaaaaaacatATTCAACGGATGCACGATGACAATCGTCCGAAATATATATGCGATTTGTGTGGTAAAGAAGTGACAACAGCGAAAAGTTTACAACATCACAAAAATGTCCATAACGGTATCAAATTGAATGAATGTAAAGTGTGTGGTAAGAAATTCAATCGACAAAATACATTAAAAGCTCATCTACGTACACATTCCGGTGAGAAACCGTACAATTGTCAATTCTGTCATAAATCATTCTCACAAAGTACATCATTGAAAATACACATGCGATATCATACGGGTGAACGACCGTATATTTGTCATATTTGTCAACAGAAATTTGTTAGTAAAGGTGTTTTAACGCTgcatataaaaaataaacataaatcataa
Protein Sequence: MKSHLVLHTDHRLHSCDKCGKTFKRKYERDRHGCYDDMFECDVCHRKLGNSYNLKNHRRRHFDDYKVKCEICGSGCMSGAELRQHIDRKHNKNSDKYRNRSADIVHLCNICGVSLTGGTTSLKHHLKRHEANYKENRNFKCKFCTKSFMQELHLKKHIQRMHDDNRPKYICDLCGKEVTTAKSLQHHKNVHNGIKLNECKVCGKKFNRQNTLKAHLRTHSGEKPYNCQFCHKSFSQSTSLKIHMRYHTGERPYICHICQQKFVSKGVLTLHIKNKHKS

Sequence clustering based on sequence similarity using MMseqs2