Zghe008799.1
Basic Information
- Insect
- Zaprionus ghesquierei
- Gene Symbol
- fru
- Assembly
- GCA_018904095.1
- Location
- JAEIGP010000090.1:3269230-3275598[+]
Transcription Factor Domain
- TF Family
- zf-BED
- Domain
- zf-BED domain
- PFAM
- PF02892
- TF Group
- Zinc-Coordinating Group
- Description
- The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 3 0.075 1.1e+02 2.8 1.7 18 27 16 25 11 30 0.86 2 3 0.00017 0.24 11.3 0.1 11 28 145 160 137 161 0.81 3 3 4.1e-08 6e-05 22.8 4.6 3 44 161 197 159 197 0.95
Sequence Information
- Coding Sequence
- ATGCGGCTCACCTTCGAGCGCCTCTCGGGCGGCTGCAATCTGCATCGCTGCAAGCTGTGCGGCAAGGTCGTGACGCACATACGCAACCACTACCACGTGCACTTTCCCGGACGCTTTGAGTGCGCCTCGATTCGTCACCATCTCTCGACACCGCTCTCCACATCATCGTCCGCGTCGCCGCCGCCGCCAACGTTCGGCATGCATCTGACTGCGGCACTGAAGAACGAATACCATCCGTTGCACTATATACGCGCTGCGGGCAATGGACAGCACAACAACAATAACACGTCGGGCGGCACACCCCCCGCCCATGGTGGGTACAATCCAGCGCAGGCAGCGGGCATGGGCGGCGGTGGGAGTACACCCAGCGGCGCGGGTCACAATTCACATCACACCATGTCGTACCACAATATGTTCACACCGTCACGCGATCCGGGCACCATGTGGCGCTGCCGATCCTGCGGCAAGGAGGTAACCAATCGCTGGCATCACTTTCACTCGCACACCGCGCAGCGCTCCATGTGTCCCTATTGCCCGGCCACGTATAGTCGGATCGATACGTTGCGCTCACATTTGCGGGTCAAGCATCCGGATCGGCTGCTCAAGCTCAACTCATCCATATAA
- Protein Sequence
- MRLTFERLSGGCNLHRCKLCGKVVTHIRNHYHVHFPGRFECASIRHHLSTPLSTSSSASPPPPTFGMHLTAALKNEYHPLHYIRAAGNGQHNNNNTSGGTPPAHGGYNPAQAAGMGGGGSTPSGAGHNSHHTMSYHNMFTPSRDPGTMWRCRSCGKEVTNRWHHFHSHTAQRSMCPYCPATYSRIDTLRSHLRVKHPDRLLKLNSSI
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00585344;
- 90% Identity
- iTF_01554834;
- 80% Identity
- -