Yevo015022.1
Basic Information
- Insect
- Yponomeuta evonymella
- Gene Symbol
- HLF
- Assembly
- GCA_963969515.1
- Location
- OZ018355.1:871011-871637[+]
Transcription Factor Domain
- TF Family
- TF_bZIP
- Domain
- bZIP domain
- PFAM
- AnimalTFDB
- TF Group
- Basic Domians group
- Description
- bZIP proteins are homo- or heterodimers that contain highly basic DNA binding regions adjacent to regions of α-helix that fold together as coiled coils
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 1e-09 3.9e-07 30.9 5.4 5 47 146 188 142 196 0.92
Sequence Information
- Coding Sequence
- atgtctctttggacaccatacgatcctgagcaagtgctcgacctgagcaagactgctgcagccgtcgtgaaaaccgacatggaaccgccgccaaggcaatctttgccggcgACAATCTTcgtgccctaccagccttacgagttgccgcccaagcctctgcagcacagcccaGTGGGCTACGGGGATTCGCCGCTGGCTTCGAGCCCTGACTCGGGGAATTCTTcatcgagccgcccgcttccgcggccgttcaaggcagtgacagcggcgctgcccgcgtgcggggtgtcggcggagcccgacccgcgctacgtcgccttccgtgcgacgatgttggaggcgatgcgcgccagaaatggcggtacgctgacggtgtcaaacccgcgcatgcggcgcgcggtccatcgcaacgctgaggtgggcgaggacgcggattacCTGCAGCAGCGCGCGCGCAACTACGCCGCCGCGAAACGGAGCCGCGACCTGCGGAAGCAGAAGGAGGATGAGCTGGCCATCCGCGTCGCCTTCCTCGAGCGCCAGAATGCTGAGCTGCGGGAGCAGCTGCTGACCGCCACAGCCTCCGTCCGCTGCCCGCGCTGTCTCGCTGACTACCCCGGATATTGA
- Protein Sequence
- MSLWTPYDPEQVLDLSKTAAAVVKTDMEPPPRQSLPATIFVPYQPYELPPKPLQHSPVGYGDSPLASSPDSGNSSSSRPLPRPFKAVTAALPACGVSAEPDPRYVAFRATMLEAMRARNGGTLTVSNPRMRRAVHRNAEVGEDADYLQQRARNYAAAKRSRDLRKQKEDELAIRVAFLERQNAELREQLLTATASVRCPRCLADYPGY
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01546374;
- 90% Identity
- iTF_01543635;
- 80% Identity
- -