Yevo014993.2
Basic Information
- Insect
- Yponomeuta evonymella
- Gene Symbol
- HLF_37
- Assembly
- GCA_963969515.1
- Location
- OZ018355.1:845244-845892[+]
Transcription Factor Domain
- TF Family
- TF_bZIP
- Domain
- bZIP domain
- PFAM
- AnimalTFDB
- TF Group
- Basic Domians group
- Description
- bZIP proteins are homo- or heterodimers that contain highly basic DNA binding regions adjacent to regions of α-helix that fold together as coiled coils
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 2.6e-10 9.7e-08 32.8 4.8 5 47 125 167 121 175 0.93
Sequence Information
- Coding Sequence
- atgtctctttggacaccatacgatcctgagcaagtgctcgacctgagcaagactgctgcagccgtcgtgaaaaccgagattgaaccgccgccaaggcaatctttgccggcggccactggtccactcctgtatactcatctcgtgccctaccagccttacgagttgccgcccaagcctctgcagcacagcccagcggtgacagcggcgctgcccgcgtgcggggtgtcggcggagcccgacccgcgctacgtcgcctttcgtgcgacgatgttggaggcgatgcgcgccagaaatggcggtacgatgacggtgtcaaacccgcgcatgcggcgcgcggtccatcgcaacgctgaggtgggcgaggacgcggattacctgcagcggcgcgcgcgcaacaacgccgccgcgaaacggagcggcgacctgcggaagcagaaggaggatgagctggccatccgcgtcgccttcctcgagcgccagaatgctgagctgcgggagcagctgctgaccgccacagcctccgtccgctgcccgcgctgtctcgctggctaccccggatattga
- Protein Sequence
- MSLWTPYDPEQVLDLSKTAAAVVKTEIEPPPRQSLPAATGPLLYTHLVPYQPYELPPKPLQHSPAVTAALPACGVSAEPDPRYVAFRATMLEAMRARNGGTMTVSNPRMRRAVHRNAEVGEDADYLQRRARNNAAAKRSGDLRKQKEDELAIRVAFLERQNAELREQLLTATASVRCPRCLAGYPGY
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01546374;
- 90% Identity
- iTF_01542689;
- 80% Identity
- -