Basic Information

Insect: Xylophagus ater
Gene Symbol: Kr
Assembly: GCA_963422695.1
Location: OY730478.1:48390225-48391486[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 5.5e-06 0.0004 21.5 2.1 2 23 87 108 86 108 0.97

2 9 0.00013 0.0096 17.2 0.1 3 23 116 137 114 137 0.95

3 9 0.015 1.1 10.7 0.5 1 23 144 169 144 169 0.93

4 9 1.1e-05 0.00077 20.6 0.5 2 23 177 198 176 198 0.97

5 9 2.2e-05 0.0016 19.6 5.5 1 23 204 226 204 226 0.98

6 9 0.00063 0.046 15.1 0.5 1 23 232 254 232 254 0.97

7 9 0.0072 0.52 11.7 4.2 1 23 260 283 260 283 0.97

8 9 3.4e-06 0.00024 22.2 2.0 1 23 290 312 290 312 0.98

9 9 0.00011 0.0081 17.4 1.1 1 22 318 339 318 339 0.95

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	5.5e-06	0.0004	21.5	2.1	2	23	87	108	86	108	0.97
2	9	0.00013	0.0096	17.2	0.1	3	23	116	137	114	137	0.95
3	9	0.015	1.1	10.7	0.5	1	23	144	169	144	169	0.93
4	9	1.1e-05	0.00077	20.6	0.5	2	23	177	198	176	198	0.97
5	9	2.2e-05	0.0016	19.6	5.5	1	23	204	226	204	226	0.98
6	9	0.00063	0.046	15.1	0.5	1	23	232	254	232	254	0.97
7	9	0.0072	0.52	11.7	4.2	1	23	260	283	260	283	0.97
8	9	3.4e-06	0.00024	22.2	2.0	1	23	290	312	290	312	0.98
9	9	0.00011	0.0081	17.4	1.1	1	22	318	339	318	339	0.95

Sequence Information

Coding Sequence: ATGTCAAAAGATGATTTATTATCGGATGAAATGACTAATTGTATAAAAGAAGAATTAGTTGAACTAAATTATGATCAAGAAGTTGATGAAAGTATGGAGTGTTCTCCAAAGCCAAGTAAAGATTCTGTTAAAGAAGAAACTAATGATCGCAAAATCGAAACAACATCTGAACCGAAAAATGATGATAATCTATCAGAAGatgagaaaaaaatagaaattctaaAACCAGTTTATCGAAAAAAGCCTCTAAAACTTATGAGCTGTGAACTTTGTCCAAAGAAATTCTATAAAGAATCGAGTCTTCATGCACACATGAGGACACATAAAGGATTGAAgCCATACGGTTGTAATATTTGTGACAAACAATTTAACTTGAAAGAATCATTGACTGTTCATCTTGAAGTCGTTCATAGCGATTCCACGAAACTTTACAGTTGTGCAGAGCCTGGATGTGACAAGGCATATAGAACTAAACGAGTTCTGGGATTACATCACAAGAAGGCACATCTTAAGGTACCAACAGAATGTGTTTGTGAAGAGTGCGGAAAAGTGCTAGCAAGCAGGGCATCATTAAgtAGCCATTTACGTACTCACACAAAAGAATTGCCATTCAAATGCGAGAAATGTGAGAAACGATTTACAACTCGCCATAAATTGAAGGAGCATGTTATGCGTCATGATGGTATCAGGAATTTCGTTTGTACATATTGTGGTGTAAAGAAAACAACTAAAGATGAATTAAATATCCATATAAATTATCATACAAAGGAAAAAGTTTATAAATGTCCTCATTGCTCGTCAACATATTCACATACTAGTAGTTTAAATTTCCATATTAAAATTGTACACATGCAAAGAGGAAAAGCTTACTCCTGTACTTATTGTACTAAAACTTTTGCACAGCCCGTTACTTTGGCTCATCATACTATGACTCATACTGGCGAAAAACCATTTGAATGCAAAGCTTGTAAAAAACGTTTTATTCAGAGATCTGGTCTAAGGACGCATTTGAAACGATATACAGAATGCCAAATGAATCAGGGAGAAATTACTAAaagctaa
Protein Sequence: MSKDDLLSDEMTNCIKEELVELNYDQEVDESMECSPKPSKDSVKEETNDRKIETTSEPKNDDNLSEDEKKIEILKPVYRKKPLKLMSCELCPKKFYKESSLHAHMRTHKGLKPYGCNICDKQFNLKESLTVHLEVVHSDSTKLYSCAEPGCDKAYRTKRVLGLHHKKAHLKVPTECVCEECGKVLASRASLSSHLRTHTKELPFKCEKCEKRFTTRHKLKEHVMRHDGIRNFVCTYCGVKKTTKDELNIHINYHTKEKVYKCPHCSSTYSHTSSLNFHIKIVHMQRGKAYSCTYCTKTFAQPVTLAHHTMTHTGEKPFECKACKKRFIQRSGLRTHLKRYTECQMNQGEITKS

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -