Xsex005085.1
Basic Information
- Insect
- Xestia sexstrigata
- Gene Symbol
- grn
- Assembly
- GCA_941918865.2
- Location
- CALNXB020000072.1:278392-278748[+]
Transcription Factor Domain
- TF Family
- zf-GATA
- Domain
- zf-GATA domain
- PFAM
- PF00320
- TF Group
- Zinc-Coordinating Group
- Description
- This domain uses four cysteine residues to coordinate a zinc ion. This domain binds to DNA. Two GATA zinc fingers are found in the GATA transcription factors. However there are several proteins which only contain a single copy of the domain.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 5.6e-20 1.7e-16 60.1 6.8 1 35 24 57 24 58 0.97 2 2 1.2 3.7e+03 -1.8 0.1 28 35 61 68 61 69 0.84
Sequence Information
- Coding Sequence
- ATGAAATCTAACCACCACCCATCTTTGTTACAGTCGCTACAAAGCGCAGCCCGGCGGGCAGGCACCTCGTGCGCCAACTGCAAGACTACGACTACGACCCTTTGGCGACGCAACCAGAACGGCGAGCCCGTCTGTAACGCGTGCGGCCTTTACTACAAACTACATAATGTAAGTACACCTTTACGCTACAAATTGTACGGAAATAGACTAGTGCGTCAATCGAGCTGTAGAAATAAACAGGCCGTGCGGCTGATGGGATTTTCCATTGGTAACTTATCAGGAGCCCCCGATAAAAAATCCTCTACCTCTAAAATGACGCATAAAACACTGAAAGTTGACAGACCTATTATAAACTGA
- Protein Sequence
- MKSNHHPSLLQSLQSAARRAGTSCANCKTTTTTLWRRNQNGEPVCNACGLYYKLHNVSTPLRYKLYGNRLVRQSSCRNKQAVRLMGFSIGNLSGAPDKKSSTSKMTHKTLKVDRPIIN
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -