Basic Information

Insect: Xanthostigma xanthostigma
Gene Symbol: -
Assembly: GCA_963575645.1
Location: OY754469.1:9809503-9810429[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 0.0046 0.095 13.7 1.5 1 23 31 53 31 53 0.92

2 10 2.2e-05 0.00045 21.0 1.1 1 23 59 82 59 82 0.90

3 10 0.0027 0.055 14.5 1.2 2 23 88 109 87 109 0.96

4 10 0.043 0.89 10.7 3.9 2 23 115 137 114 137 0.94

5 10 1.5e-05 0.0003 21.6 4.2 1 23 141 164 141 164 0.97

6 10 1.7e-05 0.00035 21.4 0.5 2 23 174 195 173 195 0.96

7 10 6.2e-06 0.00013 22.8 0.2 1 23 198 220 198 220 0.98

8 10 5.9e-06 0.00012 22.8 1.9 2 23 227 248 226 248 0.96

9 10 2.1e-06 4.4e-05 24.2 1.9 1 23 254 276 254 276 0.98

10 10 7.8e-05 0.0016 19.3 0.3 1 23 282 305 282 305 0.97

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	0.0046	0.095	13.7	1.5	1	23	31	53	31	53	0.92
2	10	2.2e-05	0.00045	21.0	1.1	1	23	59	82	59	82	0.90
3	10	0.0027	0.055	14.5	1.2	2	23	88	109	87	109	0.96
4	10	0.043	0.89	10.7	3.9	2	23	115	137	114	137	0.94
5	10	1.5e-05	0.0003	21.6	4.2	1	23	141	164	141	164	0.97
6	10	1.7e-05	0.00035	21.4	0.5	2	23	174	195	173	195	0.96
7	10	6.2e-06	0.00013	22.8	0.2	1	23	198	220	198	220	0.98
8	10	5.9e-06	0.00012	22.8	1.9	2	23	227	248	226	248	0.96
9	10	2.1e-06	4.4e-05	24.2	1.9	1	23	254	276	254	276	0.98
10	10	7.8e-05	0.0016	19.3	0.3	1	23	282	305	282	305	0.97

Sequence Information

Coding Sequence: atgaaacaagaaattCAAGAAGATGGGAATGAAAATCCTGCTTTGACGGACGAAATAAAAACTGCTGGTTACATTAAAGTGCCGTACGGGTATCGCTGTAAGCAGTGCGGAAAAGAGTTTCAGTACAAATGGGGTTGGATTAGACACAATTTTAATCACAATAAATTACGTCCTTTCGTCTGCAAGGTATGCGGAAAATCGTTTAAAACTAGATACGATATGAAAATCCACAATGTTAAAATGCATCGAGACATTTATTTGATTTGCAGTATTTGCAACGAAATATGCGACAGCAAAGAATCGCTGAGATTGCATCAAAGCAAGCACGGCGATGTATTGTTGAAATGTCGATTTTGTTGCGAAAAGTTCAGAACGAAAATCGAGCTGAAAAAACACATGAATGGTGATCATAAAGGCGCATATGATTGTGATAAATGTCACAAGTCGTTTTTCAACAAAGGAAATTTAAAAGTACACTATAAAAAAGTACACGATAACGGTTATTCCGTACCGAAACTGGAGTGCGATAAATGCGGCAAAGCGTACAAATCGCGTCAAAAATTGAACGTGCATTTACGGGGCCACGAAGGGTTCACTTGTGACGTTTGCGGGAAAGTTTTGACGCGCAAGTGGAGTCTGGAACAACACTTGTTGTCTCATAGCGGCGAGAAACCGTTGAACTGTGAAATGTGCGGCAAAAGGTTTACAAAGACGTTTAATTTGACGCTGCACCTAAGAACACAtaccggagagaaaccgtacgagTGCAAGCAGTGCGGAAAGCGATTTTCGACCCGTACTTCGTACGTCGTTCACATCAGATACCATACCGGGGAGCGACCGTATCCTTGTGAGCTTTGCGATAAAGCGTTTGTGACCAGAACCCAAATGATGTCGCATGTACAACGAAATCATAACAGAAGATGA
Protein Sequence: MKQEIQEDGNENPALTDEIKTAGYIKVPYGYRCKQCGKEFQYKWGWIRHNFNHNKLRPFVCKVCGKSFKTRYDMKIHNVKMHRDIYLICSICNEICDSKESLRLHQSKHGDVLLKCRFCCEKFRTKIELKKHMNGDHKGAYDCDKCHKSFFNKGNLKVHYKKVHDNGYSVPKLECDKCGKAYKSRQKLNVHLRGHEGFTCDVCGKVLTRKWSLEQHLLSHSGEKPLNCEMCGKRFTKTFNLTLHLRTHTGEKPYECKQCGKRFSTRTSYVVHIRYHTGERPYPCELCDKAFVTRTQMMSHVQRNHNRR

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_01511299;
90% Identity: -
80% Identity: -