Basic Information

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.00011 0.007 16.2 1.3 1 21 82 102 82 103 0.95

2 6 0.98 62 3.8 0.7 1 8 111 118 111 124 0.81

3 6 0.0015 0.097 12.6 2.6 1 20 146 165 146 167 0.95

4 6 2.8 1.8e+02 2.4 5.2 1 13 175 187 175 188 0.87

5 6 0.00019 0.012 15.5 0.1 1 21 189 209 189 210 0.95

6 6 0.053 3.3 7.8 5.5 1 23 218 241 218 241 0.97

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.00011	0.007	16.2	1.3	1	21	82	102	82	103	0.95
2	6	0.98	62	3.8	0.7	1	8	111	118	111	124	0.81
3	6	0.0015	0.097	12.6	2.6	1	20	146	165	146	167	0.95
4	6	2.8	1.8e+02	2.4	5.2	1	13	175	187	175	188	0.87
5	6	0.00019	0.012	15.5	0.1	1	21	189	209	189	210	0.95
6	6	0.053	3.3	7.8	5.5	1	23	218	241	218	241	0.97

Coding Sequence: ATGCCGAAGAGTCAAGGGCCAAGAGGAAATATGCTAAGGGTGAACGGTTTTGGTGTTCACAGTGTTCAAGAGTATTCTATAAGCAATTATCTTAAAGTTATTTGTTCTCATTCTAAACGTCCAAAATCAATGACTTGCTTTCTTCTTGTTTTCAGAGATATACCATGTCCAGGAGCAAAAGAAATACTTGGTGACGTGGAGTCAAAGACATTAAGCTATTCGGTTAATTTTAGAAAAAAAAAATTTCCATGTCCGAAATGTGTAAGAACTTTCGTTCGGAAATGTGATTTGGGTAGACACTTGAAGTACGAATGTGGTCAAGCACCAAGATTTCAATGTCCTTATTGCTCTTATCTATCTAAGCAACGGAAAGTGAAACCACGTGCCCAGGAGTTAAAGAAACAAAGTTATCATACGAAAATTGGTCGTAGAAAGTTTCCATGTCCAAAGTGTTCAAGTACTTTTGTTCATAAGCATGATGTGAAGAAACATTTGACTTTCATATGCGGTCAGACACCAAGATTTAAATGTCCTTATTGCAATAATTGCACTAAAAGCAAAAAGTTTCCATGTCCAAACTGTCCAAGTGCGTTCGGTCAAAAGCCTAGTCTGACTAGACACTTGAAGTATGAATGCGGTCAGGAACCAAGATTCCAGTGTCCTTATTGTCATCACCGAAGTAAAAAGACATCGGATGTTTATGGTCATGTTAGAAGGAAGCACACGGATTTAAAAGTCTTCGCCATCGATATTCATAAGTGA
Protein Sequence: MPKSQGPRGNMLRVNGFGVHSVQEYSISNYLKVICSHSKRPKSMTCFLLVFRDIPCPGAKEILGDVESKTLSYSVNFRKKKFPCPKCVRTFVRKCDLGRHLKYECGQAPRFQCPYCSYLSKQRKVKPRAQELKKQSYHTKIGRRKFPCPKCSSTFVHKHDVKKHLTFICGQTPRFKCPYCNNCTKSKKFPCPNCPSAFGQKPSLTRHLKYECGQEPRFQCPYCHHRSKKTSDVYGHVRRKHTDLKVFAIDIHK

Sequence clustering based on sequence similarity using MMseqs2