Basic Information

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.44 59 5.7 0.0 1 23 85 107 85 107 0.94

2 5 0.002 0.27 13.1 0.1 2 17 114 129 114 130 0.93

3 5 0.014 1.9 10.4 0.1 1 15 141 155 141 158 0.86

4 5 0.96 1.3e+02 4.7 0.1 5 23 174 189 173 189 0.82

5 5 0.0039 0.51 12.2 0.6 1 18 195 212 195 212 0.93

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.44	59	5.7	0.0	1	23	85	107	85	107	0.94
2	5	0.002	0.27	13.1	0.1	2	17	114	129	114	130	0.93
3	5	0.014	1.9	10.4	0.1	1	15	141	155	141	158	0.86
4	5	0.96	1.3e+02	4.7	0.1	5	23	174	189	173	189	0.82
5	5	0.0039	0.51	12.2	0.6	1	18	195	212	195	212	0.93

Coding Sequence: ATGTGGCCAGGACATATGTATGCTTTCAAAAGATTAGTTTTGGATACGGAGGAAGTGCTGCGAAAGCAGTTCGTCGAGATTGAGGGCGCAAATTCCGTTGACGAGGAACAACTCATAGAAGTAGATACAGAAGAAGCCATTGAGGTGAAAGACGACGATACGGATCAATTAAACCAATTGGCGAATGCAGCACAAATGAAAAAGAATGTCGAAGACATGGAATATGTGTCTGTATCTGTGCTTGATACACTATATTTGTGTGATCTTTGTGGCGATGGCTTTAAAGCACGCAATGCCTATGAAGGTCATTTAAGCATTCATGATCCAAATAATCCTAACACCTGCGAGCTGTGTGGCAAAGCATATCGCCAGGCATCATCTTTACGTACAAATATGGTATCGCATACCGGCGAACGGCCATTCCAATGTGATATATGTGGCAAATCAATGACACAGAGGTCGGCTATAAGAAACATATGCTTATTCATACCGGCGAGAAGCCGCATGCGTGCGACATACATATGCGGCCGGGAATTTCGCAATTTGATTGCACATAAACGATGGCATACGGACGCACGGCTATATGAATGCACACATTGCAAGCGCAGTTATGCATCATCGGAGCAAATGAAGCGGTATATGGTTTGTAAATCAAAGGTTGTGGAATTGCTTTAA
Protein Sequence: MWPGHMYAFKRLVLDTEEVLRKQFVEIEGANSVDEEQLIEVDTEEAIEVKDDDTDQLNQLANAAQMKKNVEDMEYVSVSVLDTLYLCDLCGDGFKARNAYEGHLSIHDPNNPNTCELCGKAYRQASSLRTNMVSHTGERPFQCDICGKSMTQRSAIRNICLFIPARSRMRATYICGREFRNLIAHKRWHTDARLYECTHCKRSYASSEQMKRYMVCKSKVVELL

Sequence clustering based on sequence similarity using MMseqs2