Trha018731.1


Basic Information
Transcription Factor Domain
Sequence Information
Similer Transcription Factors

Basic Information

Insect
Troides rhadamantus
Gene Symbol
-
Assembly
GCA_018246435.1
Location
DWLU01009829.1:4500-5090[+]

Transcription Factor Domain

TF Family
zf-C2H2
Domain
zf-C2H2 domain
PFAM
PF00096
TF Group
Zinc-Coordinating Group
Description
The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 4 0.00033 0.084 15.5 0.2 1 23 75 98 75 98 0.95
2 4 5.2e-07 0.00013 24.2 0.5 1 23 109 131 109 131 0.98
3 4 9.1e-08 2.3e-05 26.6 1.4 1 23 137 159 137 159 0.98
4 4 6.9e-06 0.0018 20.7 0.9 1 23 165 187 165 187 0.99

Sequence Information

Coding Sequence
ATGGCGGAGGCGGCATCCCCAACCAGTCCAAGATACTTGCGTAAGAAGCGCCGACTCTCGCGCCTTCTCGACAAACTGACGGTTCAGttgcaaaataataatcattatccgCTTCCGCCTTGGCTCAACCCTCCATTATTTGATACCAAGGGGCCGGAGGACACGCCGCTCGACTTGTCCGTCAAATCTGAAATGCCAAAAGTGGAGAAGGAACCGATTGGTTACAACTGCGACACTTGTGGCCAAACCTTCGCCGTTTACGACCGACTAGCTAAACACGTCGCTTCCCGCCACCGAGAGAAAACATCAGAAGCGACCCGCGCCTACGAGTGTGAGATTTGCCGTCGGCGTTTCGCTCGTTCAGATATGCTGACGCGACACGCCCGTTTACATAGTGGCATCAAGCCCTACTCGTGTTCTGCTTGCGGGCAGGTGTTCTCACGGTCTGACCACCTGGCTACCCACCAGCGCACGCACACAGGCGAAAAGCCGTACCGGTGCCCCGTGTGCCCTTACGCCGCCTGCCGCCGCGACATGATTACACGTCACATGAGGACCCACTCCCGACGCCCGCAGCCCGCCGAAATCTAA
Protein Sequence
MAEAASPTSPRYLRKKRRLSRLLDKLTVQLQNNNHYPLPPWLNPPLFDTKGPEDTPLDLSVKSEMPKVEKEPIGYNCDTCGQTFAVYDRLAKHVASRHREKTSEATRAYECEICRRRFARSDMLTRHARLHSGIKPYSCSACGQVFSRSDHLATHQRTHTGEKPYRCPVCPYAACRRDMITRHMRTHSRRPQPAEI