Basic Information

Insect: Trionymus perrisii
Gene Symbol: ZNF711
Assembly: GCA_900050545.1
Location: FIZV01008754.1:8551-9381[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 9.2e-08 9.4e-06 26.4 1.4 3 23 2 23 1 23 0.97

2 9 1.3e-05 0.0013 19.7 4.7 1 23 29 52 29 52 0.98

3 9 0.01 1.1 10.5 0.1 3 23 67 88 66 88 0.96

4 9 0.0048 0.49 11.6 0.8 1 20 94 113 94 115 0.93

5 9 0.018 1.8 9.8 3.9 3 23 139 159 138 159 0.97

6 9 0.019 1.9 9.7 0.6 1 23 163 186 163 186 0.95

7 9 9e-05 0.0092 17.0 1.2 1 23 192 214 192 214 0.93

8 9 9e-05 0.0092 17.0 0.6 1 23 220 242 220 242 0.98

9 9 8e-07 8.2e-05 23.4 0.8 1 23 248 270 248 270 0.98

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	9.2e-08	9.4e-06	26.4	1.4	3	23	2	23	1	23	0.97
2	9	1.3e-05	0.0013	19.7	4.7	1	23	29	52	29	52	0.98
3	9	0.01	1.1	10.5	0.1	3	23	67	88	66	88	0.96
4	9	0.0048	0.49	11.6	0.8	1	20	94	113	94	115	0.93
5	9	0.018	1.8	9.8	3.9	3	23	139	159	138	159	0.97
6	9	0.019	1.9	9.7	0.6	1	23	163	186	163	186	0.95
7	9	9e-05	0.0092	17.0	1.2	1	23	192	214	192	214	0.93
8	9	9e-05	0.0092	17.0	0.6	1	23	220	242	220	242	0.98
9	9	8e-07	8.2e-05	23.4	0.8	1	23	248	270	248	270	0.98

Sequence Information

Coding Sequence: ATGTGCCACATATGCggtaaaatcttcaaataccCAGAATCCCTTAGACGGCATCTGAAAACTGTGCATTCAGACGAACGGCCTTTCAAATGTCACCAATGTAGTTCAAGTTTCAATCGTAACCACAATCTAACGATTCACATTAAAGTAGTTCATCAACGCCAAAGAGTATACGTGAAAAAGCATGTACCACGATTATGCGACTACTGCGGCAAAGTTTTACTATCAGCTCGTTCGTTAGAAGAGCACATTAGTAGTATACACACGAAAAAAGCACTTTACGAATGTGAAAAATGTGGCTCAACTTTTTATCGTAAATTAACTTACGATAAACATCGCGCGTCAGAAGAATGTGATATCACTAATCCCAAAAAATGCAACGCTCCGAAACCAGAAGAatcttttcataaattttgcgaATATTGTGGATTAGAATTTAAGAAAGAGCATTTTTATAGCAAGCATAAACTGAAACATTTGAGTAGCCATACATGCCAGATATGCTTGTTAAAATTCGACGACGGGAATTTACTAAAAGAACACATCGATTCGCAACATCCAGAAGTGAAACCTTTCGAGTGCGAAGTAtgtggtaaaaaattcaaaaataagccATTGCTCAATTGTCATCTAGTTATCCATACCGGAGAGAAACGCTACCAGTGTCCGGAGTGTCCTTTGAAGTTCTTGAAGAAGAAGTATTTGACGACTCATATTCTTGTTCATACCGGTGAGCGACCGTTCGTTTGCTCAATTTGCAACAAAGCGTTTAAACAGAGTGGTGATATGAGAAAACACAAGGCGACTCATATGCGAAAGAAGAATAATTGA
Protein Sequence: MCHICGKIFKYPESLRRHLKTVHSDERPFKCHQCSSSFNRNHNLTIHIKVVHQRQRVYVKKHVPRLCDYCGKVLLSARSLEEHISSIHTKKALYECEKCGSTFYRKLTYDKHRASEECDITNPKKCNAPKPEESFHKFCEYCGLEFKKEHFYSKHKLKHLSSHTCQICLLKFDDGNLLKEHIDSQHPEVKPFECEVCGKKFKNKPLLNCHLVIHTGEKRYQCPECPLKFLKKKYLTTHILVHTGERPFVCSICNKAFKQSGDMRKHKATHMRKKNN

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -