Basic Information

Insect: Trichoplusia ni
Gene Symbol: -
Assembly: GCA_003590095.1
Location: NC:9434730-9437549[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.012 0.61 10.4 2.1 3 23 30 50 29 50 0.97

2 8 0.00049 0.025 14.8 0.3 1 23 56 78 56 78 0.96

3 8 8e-08 4.1e-06 26.7 1.0 1 23 84 107 84 107 0.94

4 8 3.1e-05 0.0016 18.5 1.0 2 21 114 133 113 134 0.94

5 8 2.7e-05 0.0014 18.7 1.9 2 23 142 163 141 163 0.96

6 8 6.4e-06 0.00033 20.7 0.8 1 23 169 192 169 192 0.97

7 8 2.8e-06 0.00014 21.8 1.1 1 23 198 220 198 220 0.97

8 8 0.0058 0.3 11.4 5.7 1 23 226 249 226 249 0.94

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.012	0.61	10.4	2.1	3	23	30	50	29	50	0.97
2	8	0.00049	0.025	14.8	0.3	1	23	56	78	56	78	0.96
3	8	8e-08	4.1e-06	26.7	1.0	1	23	84	107	84	107	0.94
4	8	3.1e-05	0.0016	18.5	1.0	2	21	114	133	113	134	0.94
5	8	2.7e-05	0.0014	18.7	1.9	2	23	142	163	141	163	0.96
6	8	6.4e-06	0.00033	20.7	0.8	1	23	169	192	169	192	0.97
7	8	2.8e-06	0.00014	21.8	1.1	1	23	198	220	198	220	0.97
8	8	0.0058	0.3	11.4	5.7	1	23	226	249	226	249	0.94

Sequence Information

Coding Sequence: ATGTGCGATAAAGCAAATCGTTTACATACTGCAAGCGGTTTGCAGTTCCATTACCGGTCGGTACATTTGAAAAAGATTGGCGGTTTCTGCTCCAAATGCAATAAGGAGTACAAAGGTTTGCGTTCGTGGAAGAAACATGAACTAAAACACAAGAAAACTCGTGACTTCATCTGTGATATTTGTGGAAGAGGATTCTTTTTCAAGTACCAAATAAGAGAGCACGTGATGGATCACTTGGACCTCAACAAGTACGTTTGTCATGAGTGTGGGAAAATATTTACGCGGtccaaatatttgaaaATACATATGGACGGTGTTCACGCGAAAACGGGTTCAGTGAAATGTTCACATTGCAACAGAATTTTCAAAAGCAGTAAAACTTTGAGAGTTCATCTGAGTATAGTGCGGAGACCAAAAAAACTGAAATGTCAATATTGTCCCAAGGAGTTTTCGTCAGCTTGCTTCTTAAAAGACCACATGGTTATGCATAGTGATGCTCGACCATACTCCTGTCATATTTGTGGAGTAAGTTACAAGGCAAAAAGCTTGCTGAAGGTCCATATTGTTACAAAACACACAGGTCTCAAGCTTCACAAATGTGATTTGTGCGCGAAATCTTTTGGTCGTCCTGAGCAGTTGAAAAGGCATTTGAGCGTGCACACTGGATGCAGGGCACACAAGTGTATGCAGTGTGACAGATCGTTCCATGAGAGGAAGTTGTTGCAGAAACATTACGAGTTACGTCACAAGATGGCggatacaaattaa
Protein Sequence: MCDKANRLHTASGLQFHYRSVHLKKIGGFCSKCNKEYKGLRSWKKHELKHKKTRDFICDICGRGFFFKYQIREHVMDHLDLNKYVCHECGKIFTRSKYLKIHMDGVHAKTGSVKCSHCNRIFKSSKTLRVHLSIVRRPKKLKCQYCPKEFSSACFLKDHMVMHSDARPYSCHICGVSYKAKSLLKVHIVTKHTGLKLHKCDLCAKSFGRPEQLKRHLSVHTGCRAHKCMQCDRSFHERKLLQKHYELRHKMADTN

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -