Tsar014270.1
Basic Information
- Insect
- Trichomalopsis sarcophagae
- Gene Symbol
- Cebpb_1
- Assembly
- GCA_002249905.1
- Location
- NNAY01001632.1:1-2409[+]
Transcription Factor Domain
- TF Family
- TF_bZIP
- Domain
- bZIP domain
- PFAM
- AnimalTFDB
- TF Group
- Basic Domians group
- Description
- bZIP proteins are homo- or heterodimers that contain highly basic DNA binding regions adjacent to regions of α-helix that fold together as coiled coils
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 2.1e-16 2.3e-13 49.7 7.8 3 63 19 79 17 81 0.95 2 2 1.1 1.3e+03 -0.7 0.0 49 63 86 100 85 102 0.52
Sequence Information
- Coding Sequence
- ATGCCCGGGTCCGTGAGCTCGCGCAAGTCGAGCAAGTCCGTGGACAAGGCCAGCGACGAGTACAGGAGGCGCCGCGAGCGCAACAACATCGCCGTGCGCAAGAGCCGGGAGAAGGCGAaggtgcgctcgcgcgagaccGAGGAACGCGTCAAGCATCTCGTCAAGGAGAACGACGTGCTGAGGAAGAAGGTGGAGATACTCTCGGAGGAGCTGAACGTGCTCAGGTCGCTCTTCAGCAGCGTCGGCGTGCTACCGGAACAGCTGCAGCGCGAGATCTCCAGGCACATCGACCAGTTTCAGCAGCACGTGGGCGGACCGACGATGTAG
- Protein Sequence
- MPGSVSSRKSSKSVDKASDEYRRRRERNNIAVRKSREKAKVRSRETEERVKHLVKENDVLRKKVEILSEELNVLRSLFSSVGVLPEQLQREISRHIDQFQQHVGGPTM
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01113174;
- 90% Identity
- -
- 80% Identity
- -