Tpre003952.1
Basic Information
- Insect
- Trichogramma pretiosum
- Gene Symbol
- -
- Assembly
- GCA_000599845.3
- Location
- NW:3193228-3195377[-]
Transcription Factor Domain
- TF Family
- zf-C2H2
- Domain
- zf-C2H2 domain
- PFAM
- PF00096
- TF Group
- Zinc-Coordinating Group
- Description
- The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 9 6.8e-06 0.00011 21.9 0.4 1 23 30 53 30 53 0.97 2 9 0.17 2.8 8.1 3.0 8 23 66 82 65 82 0.94 3 9 0.00015 0.0025 17.7 3.3 1 23 88 111 88 111 0.97 4 9 0.00021 0.0035 17.2 0.3 1 23 117 140 117 140 0.96 5 9 1.7e-05 0.00028 20.7 0.7 1 23 146 169 146 169 0.97 6 9 0.13 2 8.5 0.3 3 23 177 198 176 198 0.91 7 9 0.0011 0.019 14.9 0.9 8 23 211 227 206 227 0.93 8 9 4e-05 0.00065 19.5 0.8 2 23 241 263 240 263 0.97 9 9 0.15 2.5 8.3 1.6 1 14 277 290 277 293 0.86
Sequence Information
- Coding Sequence
- atggataaaagtgagatgGAATACAAAAAAGGTGTCTCAATAGATAATTCAAGCGAACACGATATTGCCGTTtcagatgataaaaaatttagttgtgatatttgtcaggagacATTTACACAGGAATCAAGTTTGATAACACACCgggacacaattcacaatgaacaaaaagattTCGCAAGTAACAAATACAcaaagaaattcgagtttcgcagtcatttgagtagacaccaaagaTCTGAACACGACAGCTGCAAAGATTAcacgtgcaacaagtgtgacaggaaatttgaaaataaattgacgttactcaagcacaaaaagatATTCcacaaagttttcaaaaattacttatgtgaagtGTGCGCTAAGAGATTTGACAATAAAAGAAGTTTACTCGTGCACGTGAAGACGGTACATGACAGTCGCAAGGGTTTtgaatgcgacaaatgcgaaagaaaatttggagGAAAATCGCAATTACtaagacaccaaaagatagtacacgacgGTCGTAAAGATGTTGCATGTGAACAGTGTGAGAAGacatttggacacaaatggATTATGATACAGCATATAAAggcagtgcacgaaggtctgaaagattacgcatgcgacaggATCGAAAAGACATTTACCCAGAAAGCgcatttgttgaagcaccaaaggacagtccatgacggtcggaaagatttcgcatgtgacaagtgccaAAAGAAATGTGAAGTTTGTGCGAAACGATTTGACAATAAAAgaagtttgctcttgcacatgaAGACAGCACACAATAGTGTGAAACATTTCGCCTTAAAAGTCTTTAAAGATTACTTTTGTGAcaattgcgggaagaaatttgaaaaaaaaaatgcatttgatCAGTCATATAGCAACAGTCCATGA
- Protein Sequence
- MDKSEMEYKKGVSIDNSSEHDIAVSDDKKFSCDICQETFTQESSLITHRDTIHNEQKDFASNKYTKKFEFRSHLSRHQRSEHDSCKDYTCNKCDRKFENKLTLLKHKKIFHKVFKNYLCEVCAKRFDNKRSLLVHVKTVHDSRKGFECDKCERKFGGKSQLLRHQKIVHDGRKDVACEQCEKTFGHKWIMIQHIKAVHEGLKDYACDRIEKTFTQKAHLLKHQRTVHDGRKDFACDKCQKKCEVCAKRFDNKRSLLLHMKTAHNSVKHFALKVFKDYFCDNCGKKFEKKNAFDQSYSNSP
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -