Basic Information

Insect: Trichogramma pretiosum
Gene Symbol: -
Assembly: GCA_000599845.3
Location: NW:178806-187040[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 16 4.3e-06 7.1e-05 22.5 0.5 1 23 15 38 15 38 0.97

2 16 0.00016 0.0026 17.6 1.7 1 23 44 67 44 67 0.98

3 16 0.00052 0.0085 16.0 0.3 1 23 73 96 73 96 0.97

4 16 0.00075 0.012 15.5 0.9 1 23 102 125 102 125 0.96

5 16 0.00039 0.0064 16.4 7.2 1 23 131 154 131 154 0.97

6 16 8e-06 0.00013 21.7 0.9 1 23 160 183 160 183 0.97

7 16 1.5e-07 2.4e-06 27.2 0.4 1 23 189 212 189 212 0.98

8 16 0.2 3.3 7.9 1.3 1 23 218 241 218 241 0.95

9 16 0.0003 0.005 16.7 0.6 1 23 247 270 247 270 0.98

10 16 3.3e-05 0.00053 19.8 2.0 1 23 276 299 276 299 0.98

11 16 0.00016 0.0027 17.6 0.6 1 23 305 328 305 328 0.97

12 16 1.2e-05 0.0002 21.1 5.0 1 23 334 357 334 357 0.98

13 16 0.00029 0.0047 16.8 1.3 1 23 363 386 363 386 0.98

14 16 0.026 0.42 10.7 0.2 5 22 396 413 395 413 0.93

15 16 4.3e-06 7e-05 22.6 2.4 1 23 422 444 422 444 0.99

16 16 0.00042 0.0069 16.3 0.6 1 23 515 538 515 538 0.96

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	16	4.3e-06	7.1e-05	22.5	0.5	1	23	15	38	15	38	0.97
2	16	0.00016	0.0026	17.6	1.7	1	23	44	67	44	67	0.98
3	16	0.00052	0.0085	16.0	0.3	1	23	73	96	73	96	0.97
4	16	0.00075	0.012	15.5	0.9	1	23	102	125	102	125	0.96
5	16	0.00039	0.0064	16.4	7.2	1	23	131	154	131	154	0.97
6	16	8e-06	0.00013	21.7	0.9	1	23	160	183	160	183	0.97
7	16	1.5e-07	2.4e-06	27.2	0.4	1	23	189	212	189	212	0.98
8	16	0.2	3.3	7.9	1.3	1	23	218	241	218	241	0.95
9	16	0.0003	0.005	16.7	0.6	1	23	247	270	247	270	0.98
10	16	3.3e-05	0.00053	19.8	2.0	1	23	276	299	276	299	0.98
11	16	0.00016	0.0027	17.6	0.6	1	23	305	328	305	328	0.97
12	16	1.2e-05	0.0002	21.1	5.0	1	23	334	357	334	357	0.98
13	16	0.00029	0.0047	16.8	1.3	1	23	363	386	363	386	0.98
14	16	0.026	0.42	10.7	0.2	5	22	396	413	395	413	0.93
15	16	4.3e-06	7e-05	22.6	2.4	1	23	422	444	422	444	0.99
16	16	0.00042	0.0069	16.3	0.6	1	23	515	538	515	538	0.96

Sequence Information

Coding Sequence: ATGATAAGACACCGAAATACTGTTCATTATCATCGCAAggattacgcgtgtgacaagtgcgagaagataTTTGGAAggaaatcaaatttactcgatcaccaaaagacagtccacgaaggtcgcaaagatttcgaatgcgacaaatgtgagaaaaaatatggaattaaatcgcatttgctcgtACACCAGAgaactgtacacgaaggtcgcaaagattacgcatgcgacgcgtgtgaacagaaatttggagaaaaatcaaaattgattagacaccaaaggacagtgcatgaaggtcgcaaagattatctATGCGTTGAGTGTGAAaggaaatttggacaaatatcgcatttgctcttacaccaaagaactgtacacgaaggtcgccgagattacgcatgtgacaagtgcgagaagaaatttggacataaaacGCATTTGCTACGACACCAtaggacagttcacgaaggtcgcaaggattacgcatgcgaaaagtgcgagaaaaaatttggatataagtCAGATTTGTTGAGACACCAACAGActgtacacgagggtcgcaaagactacgaaTGTGATgattgcggaaaaaaatttggacaaaaatctgATTTGTTAatgcaccaaaggacaatacacgaaggtcgcaaagattacgcgtgtgacgcgtgtgataagaaatttggatgtAAGTCAgttttgttgaagcaccaaaaactagtacacgaaggtcaaaaagattactcatgcgacgcgtgtgaacagaaatttggagaaaaatcaaaattgattagacaccaaaggacagtgcatgaaggtcgcaaagattactcatgtgaccagtgcgagaaaaaattcggacaaaaaggTCATTTGTTAGATCACCAAAAAACTGTCCACGAAGCTCAggaagatttcgcatgtgacaagtgcgagaacaTATTTGGATATAAGTCAAGTTTGTTgagacaccaaaggacagtacacgagggtcgaaaagatttcgaatgtgacgagtgcgagaagaaatttacacgaaaatgTCATCTAATCGTTCATCGAAGGACTGTACACGAAGATCGtaaagattacccatgtgaCATGTGTGAAAGGAAATATGGACACAAATTGAATTTGCTcaaacacataaaaacagttcacaaaaatcgcaaagattttgcaagCAACAATTGCGACAAGAAATTCGtgcttaaaattaatttgatcaGGCACCGAAAGACAGTGCgcgaagatcgcaaagattattatCAATGCGAccattgcgagaagaaattcggacgcAAATCAAGCTTGATATTGCACCTGAAGATACACAAAGCTGCaaacgaaggtcgcaaagattacgcaatGGACAAGTGTGAGCAGAAATTCGTCGAAGCGAAAAATTCGATCAATTACCGAAAGACAAGATCCACCGAAAAGAAAGACCGCATGGATTTTACATGCGATAACAACGAAGAAAAGTTTGGGGATCAAAACAATGTTGGTGGACACCGATTAATAGTCTACAAAGGCCGCAacgattacgcatgcgacaagtgcgagcagaaGTTTAGGATTCAAAGCAGTTTGTTAAGGCATCGAGAGATGGTCCACAAATGCCGAAAAGATGAAACGACCAACGAGGGCAAAAGGAAATCCAAGGCTCCATCGAATAcgatcaaaaaaagaaaaaaaggcaagaaaaTTCGCAAAGACAATCTGTCTGATAGGTGCTACAATTGCCTTGTCTGTCGATATCAACGatcattgtcaaaaaaaaaaacaaaaaaactcgtGACTCGCAACGAGTGA
Protein Sequence: MIRHRNTVHYHRKDYACDKCEKIFGRKSNLLDHQKTVHEGRKDFECDKCEKKYGIKSHLLVHQRTVHEGRKDYACDACEQKFGEKSKLIRHQRTVHEGRKDYLCVECERKFGQISHLLLHQRTVHEGRRDYACDKCEKKFGHKTHLLRHHRTVHEGRKDYACEKCEKKFGYKSDLLRHQQTVHEGRKDYECDDCGKKFGQKSDLLMHQRTIHEGRKDYACDACDKKFGCKSVLLKHQKLVHEGQKDYSCDACEQKFGEKSKLIRHQRTVHEGRKDYSCDQCEKKFGQKGHLLDHQKTVHEAQEDFACDKCENIFGYKSSLLRHQRTVHEGRKDFECDECEKKFTRKCHLIVHRRTVHEDRKDYPCDMCERKYGHKLNLLKHIKTVHKNRKDFASNNCDKKFVLKINLIRHRKTVREDRKDYYQCDHCEKKFGRKSSLILHLKIHKAANEGRKDYAMDKCEQKFVEAKNSINYRKTRSTEKKDRMDFTCDNNEEKFGDQNNVGGHRLIVYKGRNDYACDKCEQKFRIQSSLLRHREMVHKCRKDETTNEGKRKSKAPSNTIKKRKKGKKIRKDNLSDRCYNCLVCRYQRSLSKKKTKKLVTRNE

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -