Basic Information

Insect: Trichogramma pretiosum
Gene Symbol: -
Assembly: GCA_000599845.3
Location: NW:968397-974591[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 17 4.3e-05 0.0007 19.4 2.5 1 23 15 38 15 38 0.96

2 17 5.7e-05 0.00094 19.0 1.0 1 23 44 67 44 67 0.95

3 17 0.00054 0.0088 16.0 2.3 1 23 73 96 73 96 0.95

4 17 0.0013 0.021 14.8 0.6 1 23 102 125 102 125 0.94

5 17 3.9 64 3.8 0.0 8 22 138 152 137 152 0.92

6 17 1.1e-05 0.00017 21.3 0.7 2 23 176 198 175 198 0.96

7 17 6.1e-05 0.00099 18.9 2.1 1 23 204 227 204 227 0.97

8 17 0.00035 0.0058 16.5 0.4 1 23 233 256 233 256 0.97

9 17 0.009 0.15 12.1 9.4 1 23 262 285 262 285 0.97

10 17 3.9e-06 6.4e-05 22.7 1.2 1 23 291 314 291 314 0.98

11 17 0.00078 0.013 15.4 0.3 1 23 320 343 320 343 0.97

12 17 4.1e-05 0.00067 19.5 1.3 1 23 349 372 349 372 0.97

13 17 1.6e-05 0.00026 20.8 1.8 1 23 378 401 378 401 0.98

14 17 1.6e-06 2.7e-05 23.9 0.6 1 23 407 430 407 430 0.98

15 17 9.3e-05 0.0015 18.4 2.5 1 23 436 459 436 459 0.96

16 17 3.5e-05 0.00058 19.7 3.5 1 23 465 488 465 488 0.97

17 17 0.0011 0.017 15.0 1.3 3 23 496 517 494 517 0.96

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	17	4.3e-05	0.0007	19.4	2.5	1	23	15	38	15	38	0.96
2	17	5.7e-05	0.00094	19.0	1.0	1	23	44	67	44	67	0.95
3	17	0.00054	0.0088	16.0	2.3	1	23	73	96	73	96	0.95
4	17	0.0013	0.021	14.8	0.6	1	23	102	125	102	125	0.94
5	17	3.9	64	3.8	0.0	8	22	138	152	137	152	0.92
6	17	1.1e-05	0.00017	21.3	0.7	2	23	176	198	175	198	0.96
7	17	6.1e-05	0.00099	18.9	2.1	1	23	204	227	204	227	0.97
8	17	0.00035	0.0058	16.5	0.4	1	23	233	256	233	256	0.97
9	17	0.009	0.15	12.1	9.4	1	23	262	285	262	285	0.97
10	17	3.9e-06	6.4e-05	22.7	1.2	1	23	291	314	291	314	0.98
11	17	0.00078	0.013	15.4	0.3	1	23	320	343	320	343	0.97
12	17	4.1e-05	0.00067	19.5	1.3	1	23	349	372	349	372	0.97
13	17	1.6e-05	0.00026	20.8	1.8	1	23	378	401	378	401	0.98
14	17	1.6e-06	2.7e-05	23.9	0.6	1	23	407	430	407	430	0.98
15	17	9.3e-05	0.0015	18.4	2.5	1	23	436	459	436	459	0.96
16	17	3.5e-05	0.00058	19.7	3.5	1	23	465	488	465	488	0.97
17	17	0.0011	0.017	15.0	1.3	3	23	496	517	494	517	0.96

Sequence Information

Coding Sequence: ATGATAAAACACCAAGCCACAATTAACAATGAACAAAAcaattacgcatgtgataagtgcgatcgaaaatttgaattccgaagtcatttgagtaggcaccaaatatcagtGCACAAAaaccgcaaagattttgcatgtgatcaatgcgagaaaaaatttgtgaaaaaatcgagtttgcttacACATCAAAAGTTGGTACACAAAAGTCGTGACGATTTctcgtgcaacaagtgcgagagaaaatttgaaaataaagcaactttacttaagcataacaaaatattccatgaggttttcaaagattatttatgtgaaaaatgtgcaaagaggtttggaaataaacagaatttgctcttgcacatcaCGAGAGTCCACGAGAATTCAGTAGATTTTAAAAGTGATaagtatgagaaaaaatttggggatcAATGCGGTTTGaccaaacaccaaaaaacaatcgatGAAATGAGCAGAGATTTTTCATGtgaacaccaaaaaatagtccacgaaggtcagaaagatttggtatgcgacaagtgtggaaaaaaatttgaaaatgaatcgcATTTAGTCATGCACATAACAACAGTCCATGAAAgtcgcaaggattacgcatgtgacaagtgcgaaaaggtATTTGGTTACAAATGCAATTTGCGTTCCCATCAAAAAgtagtccacgagggtcggaaaaatttcgcatgtgacaagtgtgagctGAAATTTAGAACAAAAGGGGATATGCTCATCCACCAacagacaatacacgaaggtcggaaggattacgcatgcgacaagtgcgagaagaaatttgggcgcAAATGTCATTTTTTCCATCACCAAAAGACGGTGCACGAAGGTATtaaagatttcgtatgcgaaaaatgcgagaaaaaatttgcacgaaaagCGCAGTTGTtcttacaccaaaaaacagttcatgacgGTGAAAAAGATTACGTGTGTGACAAATGCGGGTacaaatttggagaaaaatcaatattaataagACACCAACAGATattacacgaaggtcgtaaggattacgcatgcgacaagtgcgagaaaaaatttggacaaaaaccgcatttgcttgtgcaccaaaagacagttcatgaaggtcgcaaggattattcttgtgataagtgcgagaagaaatttagccAAAAACCGAGTTTGCTTTACCACCAAAAGACGGTGCACGAAGGTatcaaagattttgtatgcgaaaaatgcgggaaaaaatttgcacaaaaagcGAAGTTGCTCgaacaccaaaagacagttcatgaaggtaaaaaagatcacgcatgcgacaaatgcgagaagaaatttgggcttCAAGGCAATTTAagaaaacaccaaaaaaccaTGCACGAAAgtcgcagagattacgcatgcgacaagtgcgagaaaaaatttgcacataAACAGTATTTACTAAAACATCGAAGGACAGTTcatgagggtcgtaaagatatcgcatgtgacaagtgtgagaagaaatttgcacatAAACCGAGTTTGCTTTACCACAAAAAGACAGCCCATAAAGGTCAAAAAGATGATCCGTGCGACTAG
Protein Sequence: MIKHQATINNEQNNYACDKCDRKFEFRSHLSRHQISVHKNRKDFACDQCEKKFVKKSSLLTHQKLVHKSRDDFSCNKCERKFENKATLLKHNKIFHEVFKDYLCEKCAKRFGNKQNLLLHITRVHENSVDFKSDKYEKKFGDQCGLTKHQKTIDEMSRDFSCEHQKIVHEGQKDLVCDKCGKKFENESHLVMHITTVHESRKDYACDKCEKVFGYKCNLRSHQKVVHEGRKNFACDKCELKFRTKGDMLIHQQTIHEGRKDYACDKCEKKFGRKCHFFHHQKTVHEGIKDFVCEKCEKKFARKAQLFLHQKTVHDGEKDYVCDKCGYKFGEKSILIRHQQILHEGRKDYACDKCEKKFGQKPHLLVHQKTVHEGRKDYSCDKCEKKFSQKPSLLYHQKTVHEGIKDFVCEKCGKKFAQKAKLLEHQKTVHEGKKDHACDKCEKKFGLQGNLRKHQKTMHESRRDYACDKCEKKFAHKQYLLKHRRTVHEGRKDIACDKCEKKFAHKPSLLYHKKTAHKGQKDDPCD

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -