Basic Information

Insect: Trichogramma pretiosum
Gene Symbol: -
Assembly: GCA_000599845.3
Location: NW:454965-462952[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 17 0.0018 0.03 14.3 0.6 1 23 30 53 30 53 0.95

2 17 0.00061 0.01 15.8 2.0 1 23 59 82 59 82 0.94

3 17 0.0012 0.02 14.8 1.1 1 23 88 111 88 111 0.96

4 17 0.00011 0.0018 18.1 2.9 1 23 117 140 117 140 0.96

5 17 4.7e-05 0.00077 19.3 2.4 1 23 146 169 146 169 0.96

6 17 2e-06 3.3e-05 23.6 0.5 1 23 183 206 183 206 0.98

7 17 3.9e-05 0.00064 19.5 1.3 1 23 213 236 213 236 0.97

8 17 1.1e-05 0.00018 21.3 1.6 1 23 242 265 242 265 0.97

9 17 9.8e-05 0.0016 18.3 0.2 1 23 271 294 271 294 0.97

10 17 3.4e-05 0.00056 19.7 0.3 1 23 300 323 300 323 0.97

11 17 0.00031 0.005 16.7 1.4 1 23 329 352 329 352 0.97

12 17 8.3e-05 0.0014 18.5 1.9 1 23 358 381 358 381 0.97

13 17 0.0016 0.026 14.5 0.4 1 23 387 410 387 410 0.96

14 17 0.00013 0.0021 17.9 0.8 3 23 418 439 416 439 0.97

15 17 0.00046 0.0074 16.2 1.4 1 23 445 468 445 468 0.98

16 17 8.2e-06 0.00013 21.7 1.0 1 23 474 497 474 497 0.98

17 17 2.1e-05 0.00035 20.4 0.9 1 23 503 526 503 526 0.96

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	17	0.0018	0.03	14.3	0.6	1	23	30	53	30	53	0.95
2	17	0.00061	0.01	15.8	2.0	1	23	59	82	59	82	0.94
3	17	0.0012	0.02	14.8	1.1	1	23	88	111	88	111	0.96
4	17	0.00011	0.0018	18.1	2.9	1	23	117	140	117	140	0.96
5	17	4.7e-05	0.00077	19.3	2.4	1	23	146	169	146	169	0.96
6	17	2e-06	3.3e-05	23.6	0.5	1	23	183	206	183	206	0.98
7	17	3.9e-05	0.00064	19.5	1.3	1	23	213	236	213	236	0.97
8	17	1.1e-05	0.00018	21.3	1.6	1	23	242	265	242	265	0.97
9	17	9.8e-05	0.0016	18.3	0.2	1	23	271	294	271	294	0.97
10	17	3.4e-05	0.00056	19.7	0.3	1	23	300	323	300	323	0.97
11	17	0.00031	0.005	16.7	1.4	1	23	329	352	329	352	0.97
12	17	8.3e-05	0.0014	18.5	1.9	1	23	358	381	358	381	0.97
13	17	0.0016	0.026	14.5	0.4	1	23	387	410	387	410	0.96
14	17	0.00013	0.0021	17.9	0.8	3	23	418	439	416	439	0.97
15	17	0.00046	0.0074	16.2	1.4	1	23	445	468	445	468	0.98
16	17	8.2e-06	0.00013	21.7	1.0	1	23	474	497	474	497	0.98
17	17	2.1e-05	0.00035	20.4	0.9	1	23	503	526	503	526	0.96

Sequence Information

Coding Sequence: atggataaaattaGGGAGAAATCCGAAGACATCGtttcaaaagataatttaagtgaacgcGATATTATGGttttagacgaaaaaaaacatatttgtgatatttgccaggaggcaTTCACACTaaaatcaagcatgataacacaccgtgacacaattcataatgaacaaaaagttttcgcatgtgacaagtgcgaacagaaatttgagttccgaagtcatttgagtagacaccaaatattagTTCACAAAAGCCTCAAAGATTATatatgcgaccagtgcgagaagacatttctaaaaaaatcaagtttatttatacaccaaaaattagtacacaaagattaTGCAGATTTCatttgcaacaagtgcgagagaaaatttgaaaataaatcaactttactcaagcacaaaaaaattttccacgaaGTATTCcgagattacttatgtgaaaagtgtgcgaagagatttgaaACTAAACACAGTTTGATCaagcacataaagacagtgcacgagggtcaaaaagatttcgcCGTCAAAGTCTttaaagattactcatgtaaCAACTGTGATAAGGAATTTGCAAATAAGCGAAATTTAGTCTTGCACATGACAACAGCCCATGAGGGTCGTaataaagattatgcatgcgacaaatgcgagaagaaatttggaaaaaaaaaaaatttgttggagcaccaaaaaacagttcaccaaggtcgcaaagattttgcatgtgaaaaatgcgagaaaaaatttggaaaaaaatcgaacttgTTCATTCACCgaagaacagtccacgaaggccATAAAGagtacgcatgcgacaaatgcgagaaggaATTCGCACGAAAAAGGGATTTGTTAGggcaccaaaaaataatccacgaaggtcgcaaagatttcgcctgtgacaaatgcgagaaggaATTTGGACAAAGAGGGAATTTGCTAACCCACctaaaaacagtacatgatggtCTCAAAAATTtcccatgcgacaagtgcgaaaagaaattcggacataaaaaagatttgttagggcaccaaaaaatagtccacgaaggtcgcaaagatttcgcctgtgacaagtgcgaaaaaaaattcggatataaaaaagatttgttccagcaccaaaaaacagtccacgaaggttgcaaagatttcgcatgtgacaagtgcgagcagaaatctggaagtaaatcagatttgttgaaacaccaaaaaatagtccacgaaggtcgcaaagattacggatgcgacaaatgcgagaagaaatttggggaacgagGCACTTTGACCaaacaccaaagaacagtccacgaaggtcgcaaagatttcgtatgcgacaagtgtagAAAAGAATTCGGATTCAAATCAACTTTGCTtgtgcacaaaaaaacagttcatgaaggtcgcaaagattataaatgcgacaagtgtgagaaaaaattttcacaaaatggTGGTTTGttcttacaccaaaagatagtccacgaaggtaggaaagatttcgcatgcgataagtgcgagcaGACATTTGGACAAAGATcaaatttgttaaagcaccaaaaaaatgttcatgaaGGTTag
Protein Sequence: MDKIREKSEDIVSKDNLSERDIMVLDEKKHICDICQEAFTLKSSMITHRDTIHNEQKVFACDKCEQKFEFRSHLSRHQILVHKSLKDYICDQCEKTFLKKSSLFIHQKLVHKDYADFICNKCERKFENKSTLLKHKKIFHEVFRDYLCEKCAKRFETKHSLIKHIKTVHEGQKDFAVKVFKDYSCNNCDKEFANKRNLVLHMTTAHEGRNKDYACDKCEKKFGKKKNLLEHQKTVHQGRKDFACEKCEKKFGKKSNLFIHRRTVHEGHKEYACDKCEKEFARKRDLLGHQKIIHEGRKDFACDKCEKEFGQRGNLLTHLKTVHDGLKNFPCDKCEKKFGHKKDLLGHQKIVHEGRKDFACDKCEKKFGYKKDLFQHQKTVHEGCKDFACDKCEQKSGSKSDLLKHQKIVHEGRKDYGCDKCEKKFGERGTLTKHQRTVHEGRKDFVCDKCRKEFGFKSTLLVHKKTVHEGRKDYKCDKCEKKFSQNGGLFLHQKIVHEGRKDFACDKCEQTFGQRSNLLKHQKNVHEG

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -