Basic Information

Insect: Trichogramma brassicae
Gene Symbol: -
Assembly: GCA_902806795.1
Location: CADCXV010000732.1:202610-216249[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 20 0.00029 0.013 15.9 0.3 1 23 33 56 33 56 0.96

2 20 0.00011 0.0048 17.2 0.2 2 23 75 97 74 97 0.96

3 20 2.8e-05 0.0012 19.1 1.7 1 23 103 126 103 126 0.98

4 20 0.02 0.84 10.1 0.1 1 23 132 155 132 155 0.97

5 20 4.8e-06 0.00021 21.5 1.1 1 23 161 184 161 184 0.97

6 20 0.00043 0.018 15.4 1.7 1 23 194 217 194 217 0.96

7 20 8.8e-07 3.8e-05 23.8 1.3 1 23 223 246 223 246 0.95

8 20 3.5e-06 0.00015 22.0 1.0 1 23 252 275 252 275 0.97

9 20 6.4e-07 2.7e-05 24.3 2.5 1 23 281 304 281 304 0.98

10 20 9.3e-07 4e-05 23.8 3.6 1 23 310 333 310 333 0.98

11 20 0.00026 0.011 16.1 0.7 1 23 339 362 339 362 0.97

12 20 7.8e-05 0.0033 17.7 0.5 1 23 368 391 368 391 0.97

13 20 6.1e-05 0.0026 18.0 1.8 1 23 397 420 397 420 0.97

14 20 1.1e-05 0.00049 20.3 2.3 1 23 426 449 426 449 0.97

15 20 0.021 0.89 10.1 0.3 1 23 455 480 455 480 0.95

16 20 1.2e-05 0.0005 20.3 0.9 1 23 486 509 486 509 0.98

17 20 5.9e-05 0.0025 18.1 3.1 1 23 515 538 515 538 0.97

18 20 1.6e-05 0.00069 19.8 0.5 1 23 544 567 544 567 0.97

19 20 1.7e-05 0.00072 19.8 1.3 1 23 573 596 573 596 0.97

20 20 0.0041 0.18 12.3 2.1 1 23 602 625 602 625 0.97

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	20	0.00029	0.013	15.9	0.3	1	23	33	56	33	56	0.96
2	20	0.00011	0.0048	17.2	0.2	2	23	75	97	74	97	0.96
3	20	2.8e-05	0.0012	19.1	1.7	1	23	103	126	103	126	0.98
4	20	0.02	0.84	10.1	0.1	1	23	132	155	132	155	0.97
5	20	4.8e-06	0.00021	21.5	1.1	1	23	161	184	161	184	0.97
6	20	0.00043	0.018	15.4	1.7	1	23	194	217	194	217	0.96
7	20	8.8e-07	3.8e-05	23.8	1.3	1	23	223	246	223	246	0.95
8	20	3.5e-06	0.00015	22.0	1.0	1	23	252	275	252	275	0.97
9	20	6.4e-07	2.7e-05	24.3	2.5	1	23	281	304	281	304	0.98
10	20	9.3e-07	4e-05	23.8	3.6	1	23	310	333	310	333	0.98
11	20	0.00026	0.011	16.1	0.7	1	23	339	362	339	362	0.97
12	20	7.8e-05	0.0033	17.7	0.5	1	23	368	391	368	391	0.97
13	20	6.1e-05	0.0026	18.0	1.8	1	23	397	420	397	420	0.97
14	20	1.1e-05	0.00049	20.3	2.3	1	23	426	449	426	449	0.97
15	20	0.021	0.89	10.1	0.3	1	23	455	480	455	480	0.95
16	20	1.2e-05	0.0005	20.3	0.9	1	23	486	509	486	509	0.98
17	20	5.9e-05	0.0025	18.1	3.1	1	23	515	538	515	538	0.97
18	20	1.6e-05	0.00069	19.8	0.5	1	23	544	567	544	567	0.97
19	20	1.7e-05	0.00072	19.8	1.3	1	23	573	596	573	596	0.97
20	20	0.0041	0.18	12.3	2.1	1	23	602	625	602	625	0.97

Sequence Information

Coding Sequence: atggagtttttatacttttataaaagtataagtATGGGTCCacataatacttttttacaaaatcgtacgcacacaatacacgaaggtttcaaagattatgcttgtgataagtgcgaaaagaaattcggacaaaaaccAACTTTGCTCGcccataaaaaaatagttcacgaTGGTCAGAAAGAtaacgcatgcgacaagttccatgaaggtcggaaagctGTCgaatgtgataaatgcgagaagatattcggacaaaaaaaaactctgcTCGCccatcaaaaaatagttcacgatggtcggaaagatttcacatgcgacgAGTGtaagcagaaatttggacgaaaatcggaTATGTTAAATCACCggaggacagtacacgaaggtcgtaaagattacgcatgcgaccaATGCGAGATAAAAGTTGGATATAAATGGCTTTTGCTACGCCACCAAAAGATGGTACATGAAAAtaggaaagattacgcatgcgacaagtgcaagaagaattttggacaaaaatctaGCTTACTTTtgcatcaaaggacagtccatgaaggtctccacgagggtcccaaagattttgcatgcgatgaGTGCGGagagaaatttagaaaaaagacGCATTTAATCTTCCACCTAAacacagtacacgaaggtcgcgaaaattacttatgtgacaattgcgggaagaaatttggagatagaagcaatttgaaaagacataaaaatacagttcacgaaggtcgcaaagattacgcatgtgacaaatgtgagaaaaaatttggaagtcgatcagatttgttaaagcaccaaaagacagtacacgaaggttgcaaagattatacTTGTaataagtgtgagaagaaattcggacgaAAATCGGATTTGCtaaagcaccaaaaaacagtccatgagggtcgcaaagattttacatgtgatatctgcgagaaaaaatttaaacaaaaatcacatttgcttttgcatcaaaaaacagttcacagAGGTCgaaaagactacgcatgcgacaagtgcgaaaacaAATTCGGAACAATATCAGATTTGTTtcggcaccaaaagacagtccatgaaggtcgaaaagattactcatgtgacaagtgcgagaaaaaatttggagaaaaatcggtATTGATCAGACATCAAAAGATAATACACGAAGGCCGCAAGGATTATGCttgtgataagtgcgagaagaaatttggacacaaatggactttgcttttacaccaaaggacagtacacgaaggtcgtagagattacgcatgcgacaagtgcgaccGGAAATTTGGAGAAAGATCTCATTTGCTCAGGCACCAAAAGACGATACATGAAGGTCAGAGAAATttcgtatgcgacaagtgcgagagcgaggagaaatttggaagtaagTCAGATTTATTAAAGCACCGCAAGGCAGTACACAATGAATACAAtgattacccatgcgacaagtgcgaaaataaatttggacaaaaatcagatttgtcgAAGCATCAAAGAACAGTTCATAAGGGTCGCAATGATTACccatgcgaaaagtgcgagaaaaaatttagggaCACACACGGTCTGACTAGGCACAAAAAgtcagtccacgaaggtcgaaaagattatgctTGCGAAATGTGCGGGACGACATTTGCTCAAAAAGTGCACATGGTtatccaccaaaagacaatacacgaaggtcgtagaGATTTCATATGTGACacgtgtgagaagaaatttggaaatatgtataatttacgcaaccaccaaaagacaatacacaaaggtcgcaaagatttcatatgcgacaggtgcgagagaaaatttggatgtaaatcagatttattGAGGCACCAAAGGGTAATACATTAA
Protein Sequence: MEFLYFYKSISMGPHNTFLQNRTHTIHEGFKDYACDKCEKKFGQKPTLLAHKKIVHDGQKDNACDKFHEGRKAVECDKCEKIFGQKKTLLAHQKIVHDGRKDFTCDECKQKFGRKSDMLNHRRTVHEGRKDYACDQCEIKVGYKWLLLRHQKMVHENRKDYACDKCKKNFGQKSSLLLHQRTVHEGLHEGPKDFACDECGEKFRKKTHLIFHLNTVHEGRENYLCDNCGKKFGDRSNLKRHKNTVHEGRKDYACDKCEKKFGSRSDLLKHQKTVHEGCKDYTCNKCEKKFGRKSDLLKHQKTVHEGRKDFTCDICEKKFKQKSHLLLHQKTVHRGRKDYACDKCENKFGTISDLFRHQKTVHEGRKDYSCDKCEKKFGEKSVLIRHQKIIHEGRKDYACDKCEKKFGHKWTLLLHQRTVHEGRRDYACDKCDRKFGERSHLLRHQKTIHEGQRNFVCDKCESEEKFGSKSDLLKHRKAVHNEYNDYPCDKCENKFGQKSDLSKHQRTVHKGRNDYPCEKCEKKFRDTHGLTRHKKSVHEGRKDYACEMCGTTFAQKVHMVIHQKTIHEGRRDFICDTCEKKFGNMYNLRNHQKTIHKGRKDFICDRCERKFGCKSDLLRHQRVIH

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -