Basic Information

Transcription Factor Domain

TF Family: zf-BED
Domain: zf-BED domain
PFAM: PF02892
TF Group: Zinc-Coordinating Group
Description: The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 0.0024 2.7 8.0 0.5 18 44 36 59 30 59 0.87

2 9 0.02 23 5.1 4.4 13 43 60 87 53 88 0.82

3 9 0.00097 1.1 9.3 0.6 17 44 93 117 88 117 0.85

4 9 0.0073 8.2 6.4 0.8 17 43 122 145 118 146 0.86

5 9 0.013 15 5.6 3.1 9 44 143 175 134 175 0.79

6 9 1.8 2.1e+03 -1.2 0.0 21 30 184 193 183 198 0.84

7 9 0.002 2.2 8.3 0.6 17 43 199 222 187 223 0.86

8 9 0.0052 5.8 6.9 3.4 3 38 214 246 212 252 0.84

9 9 6e-07 0.00067 19.5 2.1 3 43 243 280 241 281 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	0.0024	2.7	8.0	0.5	18	44	36	59	30	59	0.87
2	9	0.02	23	5.1	4.4	13	43	60	87	53	88	0.82
3	9	0.00097	1.1	9.3	0.6	17	44	93	117	88	117	0.85
4	9	0.0073	8.2	6.4	0.8	17	43	122	145	118	146	0.86
5	9	0.013	15	5.6	3.1	9	44	143	175	134	175	0.79
6	9	1.8	2.1e+03	-1.2	0.0	21	30	184	193	183	198	0.84
7	9	0.002	2.2	8.3	0.6	17	43	199	222	187	223	0.86
8	9	0.0052	5.8	6.9	3.4	3	38	214	246	212	252	0.84
9	9	6e-07	0.00067	19.5	2.1	3	43	243	280	241	281	0.89

Coding Sequence: ATGAGCTTCTTATCTCGAACTGACCACTCACTCTCGAGCCCTCCTCGCCTCCCCCGAACCCTCTCGACTCTCACTCCCTTTTTCGTGCTTGTTTATACCGACTACGAGTGCGACGtgtgtaagaaaaaattttcagagaaGGGCTCTTTGATgatacacataaaaacagttcatAATAAACAAAAGGACTTCGAGTGCAAATTGTGTCAGAAAACATTTGCTACGAAAAACTATTTGaaaatacacataaaaacagttcacgataAACAAAAGGACTACGAGTGCGACGtgtgtaagaaaaaattttcagagaaGGGCTCTTTGATgatgcacataaaaacagttcatAATAAACAAAAGGACTTCGAGTGCCAATTGTGTCAGAAAACATTTGCTACGAAAAACTATTTGaaaatacacataaaaacagttcacgaaaaacaaaaagactACAAGTGCGATGTGTGTCAGAAAACATTTACACAGCAAAGCACCGTGATAAGACACCAAAAATCAGTTCATCAAGGACGAAAGGACTTAGAGGGCGACTTgtgccagaaaaaattttcacaaaagaaCGACTTGAAAAAGGACTACGAGTGCGACGTATGCCATGAAGCATTTACACGGCAGGACACCTTAAAAAGACACATAAAAATAGTTCACGATAAACAAAAGGACTACAAGTGTGACGAGTGTCACAAAGTATTTTCAGAAAAAGGCAACTTGAAGCAACACAAGAACGCAGTTCACGAAGGACAAAAGAATTTTGAGTGCGACTTGTGTcagaaaacattttcacaGCAAAGCAACTTGAAAagacacataaaaacagttcatgacaAATAA
Protein Sequence: MSFLSRTDHSLSSPPRLPRTLSTLTPFFVLVYTDYECDVCKKKFSEKGSLMIHIKTVHNKQKDFECKLCQKTFATKNYLKIHIKTVHDKQKDYECDVCKKKFSEKGSLMMHIKTVHNKQKDFECQLCQKTFATKNYLKIHIKTVHEKQKDYKCDVCQKTFTQQSTVIRHQKSVHQGRKDLEGDLCQKKFSQKNDLKKDYECDVCHEAFTRQDTLKRHIKIVHDKQKDYKCDECHKVFSEKGNLKQHKNAVHEGQKNFECDLCQKTFSQQSNLKRHIKTVHDK

Sequence clustering based on sequence similarity using MMseqs2