Basic Information

Transcription Factor Domain

TF Family: zf-BED
Domain: zf-BED domain
PFAM: PF02892
TF Group: Zinc-Coordinating Group
Description: The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 0.00014 0.077 13.1 0.9 17 41 8 29 3 31 0.90

2 9 0.0011 0.59 10.2 2.0 1 39 21 55 21 58 0.84

3 9 0.049 27 4.9 1.8 15 36 62 80 53 87 0.74

4 9 0.08 44 4.2 4.9 15 41 90 113 81 116 0.79

5 9 0.18 99 3.1 3.3 7 39 111 139 107 143 0.72

6 9 0.00014 0.079 13.0 4.2 13 41 144 169 135 171 0.83

7 9 0.00011 0.06 13.4 6.0 1 41 161 197 161 199 0.87

8 9 0.031 17 5.5 2.6 9 29 197 216 193 227 0.75

9 9 1.3 7e+02 0.4 1.8 16 27 231 242 222 243 0.73

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	0.00014	0.077	13.1	0.9	17	41	8	29	3	31	0.90
2	9	0.0011	0.59	10.2	2.0	1	39	21	55	21	58	0.84
3	9	0.049	27	4.9	1.8	15	36	62	80	53	87	0.74
4	9	0.08	44	4.2	4.9	15	41	90	113	81	116	0.79
5	9	0.18	99	3.1	3.3	7	39	111	139	107	143	0.72
6	9	0.00014	0.079	13.0	4.2	13	41	144	169	135	171	0.83
7	9	0.00011	0.06	13.4	6.0	1	41	161	197	161	199	0.87
8	9	0.031	17	5.5	2.6	9	29	197	216	193	227	0.75
9	9	1.3	7e+02	0.4	1.8	16	27	231	242	222	243	0.73

Coding Sequence: ATGCATACTGGGGAGAAACCTTTTGAATGCAAACACTGCAATGCAAAGTTTCCTCGGAAATCAAATCTGTATGCTCACATTAGAACGCATACTGGGGATAAATCTTTTGAATGCCCACACTGCAATTCAAAATTTTCTCAGCAATCCCATCTGAATAATCACATTAGAATGCAAACTGGGGAGAAACCTTTCGAATGCGCACATTGCAATTCAAAATTTTCTCAGAAATATACTCTGCGTGTTCATGTTAGAACGCATACTGGGGATAAACCTTTTGAATGCACACACTGCAATTCAAAATTTTCTCACAAATCCACTCTGCATGCTCATGTTAGAACGCATACTGGGGATAAACCTTTTGAATGCCCACACTGCAATTCAAAATTTTCTCAGCAATCCCATCTGAATTATCACATTAGAATGCATACTGGGGAGAAACCTTTTGAATGCACACACTGCAATGCAAAGTTTTCTCGGAAATCAAATCTGTATGCTCACATTAGAACGCATACGGGGGATAAACCTTTTGAATGCACACACTGCAATAAAAAATTTTCTCGCAAATCCCAACTGAACAATCATATTAGAACGCATACTGGGGATAAATCTTTTGAATGCACACACTGCAATTCAAAATTTTCTCAGAAATTTGATCTGCGTGTTCATGTTAGAACGCATACTGGGGATAAACCTTTTGAATGCCCACACTGCAATGCAAAATGTTCGCACTAA
Protein Sequence: MHTGEKPFECKHCNAKFPRKSNLYAHIRTHTGDKSFECPHCNSKFSQQSHLNNHIRMQTGEKPFECAHCNSKFSQKYTLRVHVRTHTGDKPFECTHCNSKFSHKSTLHAHVRTHTGDKPFECPHCNSKFSQQSHLNYHIRMHTGEKPFECTHCNAKFSRKSNLYAHIRTHTGDKPFECTHCNKKFSRKSQLNNHIRTHTGDKSFECTHCNSKFSQKFDLRVHVRTHTGDKPFECPHCNAKCSH

Sequence clustering based on sequence similarity using MMseqs2