Tsti012447.1
Basic Information
- Insect
- Trachelus stipa
- Gene Symbol
- Cebpg
- Assembly
- GCA_036026315.1
- Location
- JAYRCB010000729.1:67915-68472[-]
Transcription Factor Domain
- TF Family
- TF_bZIP
- Domain
- bZIP domain
- PFAM
- AnimalTFDB
- TF Group
- Basic Domians group
- Description
- bZIP proteins are homo- or heterodimers that contain highly basic DNA binding regions adjacent to regions of α-helix that fold together as coiled coils
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 2.3e-15 2.7e-12 47.0 7.6 2 65 24 87 23 87 0.95
Sequence Information
- Coding Sequence
- ATGGCACCAAGGAACAAGGAAAATTCTGCAATGTCAAATAAGAAGAGACCAGTGTCAGAGGAGGAAGATGACGAAGATTATAGAAGACGTCGTGACAGGAATAATCAGGCTGTCAAGCGTTCCAGAGTTAAAAGTAAGCTACGTACTCAGCAAACCTTAGAACGTGTAAATCAGTTGAAAACAGAGAATGAattattagaagaaaaaattaagatgcTCACGAAGGaattaggatttttgaaagaTCTGTTCCTAGCGCATGCTGGCTCAAATCAGCATCCGATAAACTTACAAGACCTCGATTTAAATGCTCTATTGGCTGATGATACAAAGCCTGGAGATTTAAAAGGCTCGAAACTGTAG
- Protein Sequence
- MAPRNKENSAMSNKKRPVSEEEDDEDYRRRRDRNNQAVKRSRVKSKLRTQQTLERVNQLKTENELLEEKIKMLTKELGFLKDLFLAHAGSNQHPINLQDLDLNALLADDTKPGDLKGSKL
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00734318;
- 90% Identity
- iTF_00251811;
- 80% Identity
- -