Basic Information

Insect: Torymus texanus
Gene Symbol: -
Assembly: GCA_036873485.1
Location: JAYJLV010000027.1:12288502-12289676[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 0.00098 0.26 13.8 0.1 3 23 83 104 81 104 0.95

2 9 0.001 0.27 13.7 2.1 1 23 108 130 108 130 0.99

3 9 0.089 23 7.6 4.0 1 23 136 159 136 159 0.90

4 9 9.7e-05 0.025 16.9 1.1 2 23 167 189 166 189 0.95

5 9 4.3 1.1e+03 2.3 0.3 3 13 196 206 194 215 0.77

6 9 8.4e-06 0.0022 20.3 1.7 1 23 226 248 226 248 0.98

7 9 3e-05 0.0078 18.5 0.2 1 23 252 274 252 274 0.98

8 9 6.5e-06 0.0017 20.6 0.6 2 23 279 300 278 300 0.97

9 9 1.9e-06 0.00051 22.3 6.7 1 23 306 328 306 328 0.99

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	0.00098	0.26	13.8	0.1	3	23	83	104	81	104	0.95
2	9	0.001	0.27	13.7	2.1	1	23	108	130	108	130	0.99
3	9	0.089	23	7.6	4.0	1	23	136	159	136	159	0.90
4	9	9.7e-05	0.025	16.9	1.1	2	23	167	189	166	189	0.95
5	9	4.3	1.1e+03	2.3	0.3	3	13	196	206	194	215	0.77
6	9	8.4e-06	0.0022	20.3	1.7	1	23	226	248	226	248	0.98
7	9	3e-05	0.0078	18.5	0.2	1	23	252	274	252	274	0.98
8	9	6.5e-06	0.0017	20.6	0.6	2	23	279	300	278	300	0.97
9	9	1.9e-06	0.00051	22.3	6.7	1	23	306	328	306	328	0.99

Sequence Information

Coding Sequence: ATGCGAACTAACACaaatttttctaCTCCTTCCTACTCTACGTATAAGAACGGCACTACCACCAACGGTGTTTCTtctgttgctgctactactactaccaacGGCACTACCACCAATAGTATTATTATCAGCACCAATGGTACAacttctactgctgctactgcaaaTGGTAAAAGCTCGCGCACACGTCGACGTCCAAGCTGGCTAAAAGACACAGTGACTGATTTTGATGCTCTCCGCGACATCTGTCCCTACTGCGACCGTCGCTTCGAGGACGAGTACAGAGTGGCTCAACACGTGCGCAATGCTCACAAGAAGCCCTTCAAGTGCGACCTTTGCCGTCGTCAGTATTTCAGTCAGGAGGTGCTTGCGCGTCACCGCAAGACCCACAACACCGATTCACACTTCGAGTGCAGTATCTGCCATCTGAAGTACAAAAGGGAGGAGACACTCCAGTGTCATTACGTGCGCGTGCACAGCGACATCGAAGCCTCGATCACGTGCGATCATTGCGGCAAGAAGTACAAGCTGAAGCAGGACCTGCTGCTGCACATCAATCAGGTGCACATGTGCAGCTACCAGATCTGCCGGTTCTGCGGCAAGGCTGTAAAGAACGTGAAGGCGCACGAATGGCATCACCAACAAAAGCTCGAGCACGTGAAGAAGGAGATCAGATATCCGTGCAGCCTCTGCTTCAAGAAATTCCGCAGCGAGTCCAAGCTTGAGAACCATCTGATGCGTCACGTGCAGCGCTACAAGTGCTCGACCTGCGGTGAGAATTTCCCGGGTCCCGGGCAGCTGATGAATCACAAGTCGAAGCACAGGCCTGGCGTCACCTGCACCATCTGTGACAAGTTCTTCGCATCGCGCAGCAACTATTATCAGCACGTGCTGATGCACGCCAAGGTACGGCCGTACAAGTGCGACGTCTGCCACGAGTGCTTTACTCAGCGCTCAACATTGGTGCGCCACAGGAAGACCCATCCGGGTCCGATGCCCACGGAGATAAAGGTGGTTCCGATCGCCAATTTGGCCAGGAAGGTCCTGGAGAACTGGTCCTAA
Protein Sequence: MRTNTNFSTPSYSTYKNGTTTNGVSSVAATTTTNGTTTNSIIISTNGTTSTAATANGKSSRTRRRPSWLKDTVTDFDALRDICPYCDRRFEDEYRVAQHVRNAHKKPFKCDLCRRQYFSQEVLARHRKTHNTDSHFECSICHLKYKREETLQCHYVRVHSDIEASITCDHCGKKYKLKQDLLLHINQVHMCSYQICRFCGKAVKNVKAHEWHHQQKLEHVKKEIRYPCSLCFKKFRSESKLENHLMRHVQRYKCSTCGENFPGPGQLMNHKSKHRPGVTCTICDKFFASRSNYYQHVLMHAKVRPYKCDVCHECFTQRSTLVRHRKTHPGPMPTEIKVVPIANLARKVLENWS

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00464170;
90% Identity: iTF_01469966;
80% Identity: -