Tsin036996.1
Basic Information
- Insect
- Torymus sinensis
- Gene Symbol
- Cebpb
- Assembly
- GCA_030522985.1
- Location
- JAPYZP010053473.1:1-526[+]
Transcription Factor Domain
- TF Family
- TF_bZIP
- Domain
- bZIP domain
- PFAM
- AnimalTFDB
- TF Group
- Basic Domians group
- Description
- bZIP proteins are homo- or heterodimers that contain highly basic DNA binding regions adjacent to regions of α-helix that fold together as coiled coils
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 3 8.5 2.5e+04 -2.8 0.7 39 39 46 46 31 59 0.51 2 3 1.1e-14 3.2e-11 44.9 8.4 3 63 85 145 83 147 0.95 3 3 4.2 1.3e+04 -1.8 0.1 50 62 153 165 152 168 0.50
Sequence Information
- Coding Sequence
- GCGGGCTACAGCCCGGCGGGGCCCTTCGCGGCGGGCGCGCCCACCTTCGCGCCGCTGCAGCCCGCGGGCGCGCCGGGCCACGCGCACCTGCCgcacctgcagcagcagcagcagcagcaggcgcctCCAacaacgcagcagcagcagcagcagcagcagcagcgcgccatGCGCCCGGCGCACGCGCTGGGGCAGCACGTGCCGGGCGCCGTGGTCTCGCGCAAGCAGAGCAAGAGCGTGGACAAGGCGAGCGACGAGTACCGGCGGCGCCGCGAGCGCAACAACATCGCCGTGCGCAAGAGCCGCGAGAAGGCCAaggtgcgctcgcgcgagacgGAGGAGCGCGTGAAGCTGCTGGTCAAGGAGAACGACGTGCTGCGCAAGAAGGTGGAGATCCTCTCGGAGGAGCTCAACGTGCTGCGCTCGCTCTTCAGCAGCGTGGGCGTGCTGCCGGAGCAGCTGCAGCGCGAGATCTCGAGGCACATCGACCAGTTCCAGCAGCACGTGGGCGGCCCGCCGATGTAG
- Protein Sequence
- AGYSPAGPFAAGAPTFAPLQPAGAPGHAHLPHLQQQQQQQAPPTTQQQQQQQQQRAMRPAHALGQHVPGAVVSRKQSKSVDKASDEYRRRRERNNIAVRKSREKAKVRSRETEERVKLLVKENDVLRKKVEILSEELNVLRSLFSSVGVLPEQLQREISRHIDQFQQHVGGPPM
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -