Basic Information

Transcription Factor Domain

TF Family: zf-NF-X1
Domain: zf-NF-X1 domain
PFAM: PF01422
TF Group: Zinc-Coordinating Group
Description: This domain is presumed to be a zinc binding domain. The following pattern describes the zinc finger. C-X(1-6)-H-X-C-X3-C(H/C)-X(3-4)-(H/C)-X(1-10)-C Where X can be any amino acid, and numbers in brackets indicate the number of residues. Two position can be either his or cys. This family includes Swiss:P40798, Swiss:Q12986 and Swiss:P53971. The zinc fingers in Swiss:Q12986 bind to DNA [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 2.4e-08 0.00027 21.8 12.5 4 18 9 23 7 24 0.93

2 6 2.1 2.3e+04 -3.6 0.2 1 3 33 35 33 35 0.70

3 6 0.75 8.3e+03 -2.2 0.1 9 13 41 45 39 46 0.54

4 6 0.14 1.6e+03 0.1 1.1 6 10 50 54 49 54 0.89

5 6 7.7e-08 0.00085 20.1 16.3 1 18 60 77 60 78 0.98

6 6 0.067 7.4e+02 1.2 0.6 1 4 87 90 87 91 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	2.4e-08	0.00027	21.8	12.5	4	18	9	23	7	24	0.93
2	6	2.1	2.3e+04	-3.6	0.2	1	3	33	35	33	35	0.70
3	6	0.75	8.3e+03	-2.2	0.1	9	13	41	45	39	46	0.54
4	6	0.14	1.6e+03	0.1	1.1	6	10	50	54	49	54	0.89
5	6	7.7e-08	0.00085	20.1	16.3	1	18	60	77	60	78	0.98
6	6	0.067	7.4e+02	1.2	0.6	1	4	87	90	87	91	0.89

Coding Sequence: ACTCGTCTTGACACGAATTGTGTGCACAAATGCACTCTTCTCTGTCATCCTGGTTCGTGCCCACCTTGCTTGGCTATGGTTACCAAGACTTGTGGTTGTGGACGAACATCCCAAACGCAGAAATGCAGCTCGGGTCCACTGTTGCAGTGTGACGAAGTTTGTGACCGATTGCTCAATTGCGGCGTGCACAACTGCGAGACCAAGTGCCACCATGGTAGTTGCGAACCATGCGATAAAATTATCAAGCaagATTGTTATTGTGGAAAACATAGTCTAGAGAAAACGTTTGTGAGAAAGTGTTAG
Protein Sequence: TRLDTNCVHKCTLLCHPGSCPPCLAMVTKTCGCGRTSQTQKCSSGPLLQCDEVCDRLLNCGVHNCETKCHHGSCEPCDKIIKQDCYCGKHSLEKTFVRKC

Sequence clustering based on sequence similarity using MMseqs2