Tger032058.1
Basic Information
- Insect
- Torymus geranii
- Gene Symbol
- stc_2
- Assembly
- GCA_900474355.1
- Location
- UCWB01083812.1:2-462[+]
Transcription Factor Domain
- TF Family
- zf-NF-X1
- Domain
- zf-NF-X1 domain
- PFAM
- PF01422
- TF Group
- Zinc-Coordinating Group
- Description
- This domain is presumed to be a zinc binding domain. The following pattern describes the zinc finger. C-X(1-6)-H-X-C-X3-C(H/C)-X(3-4)-(H/C)-X(1-10)-C Where X can be any amino acid, and numbers in brackets indicate the number of residues. Two position can be either his or cys. This family includes Swiss:P40798, Swiss:Q12986 and Swiss:P53971. The zinc fingers in Swiss:Q12986 bind to DNA [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 6 2.4e-08 0.00027 21.8 12.5 4 18 9 23 7 24 0.93 2 6 2.1 2.3e+04 -3.6 0.2 1 3 33 35 33 35 0.70 3 6 0.75 8.3e+03 -2.2 0.1 9 13 41 45 39 46 0.54 4 6 0.14 1.6e+03 0.1 1.1 6 10 50 54 49 54 0.89 5 6 7.7e-08 0.00085 20.1 16.3 1 18 60 77 60 78 0.98 6 6 0.067 7.4e+02 1.2 0.6 1 4 87 90 87 91 0.89
Sequence Information
- Coding Sequence
- ACTCGTCTTGACACGAATTGTGTGCACAAATGCACTCTTCTCTGTCATCCTGGTTCGTGCCCACCTTGCTTGGCTATGGTTACCAAGACTTGTGGTTGTGGACGAACATCCCAAACGCAGAAATGCAGCTCGGGTCCACTGTTGCAGTGTGACGAAGTTTGTGACCGATTGCTCAATTGCGGCGTGCACAACTGCGAGACCAAGTGCCACCATGGTAGTTGCGAACCATGCGATAAAATTATCAAGCaagATTGTTATTGTGGAAAACATAGTCTAGAGAAAACGTTTGTGAGAAAGTGTTAG
- Protein Sequence
- TRLDTNCVHKCTLLCHPGSCPPCLAMVTKTCGCGRTSQTQKCSSGPLLQCDEVCDRLLNCGVHNCETKCHHGSCEPCDKIIKQDCYCGKHSLEKTFVRKC
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -