Basic Information

Insect: Tortricodes alternella
Gene Symbol: -
Assembly: GCA_947859335.1
Location: OX401978.1:8922208-8930060[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 3.5e-06 0.00022 21.8 1.4 1 23 129 151 129 151 0.97

2 7 1.3e-06 8.5e-05 23.1 2.1 2 23 160 181 160 181 0.97

3 7 3.2e-06 0.0002 21.9 0.8 1 23 187 209 187 209 0.99

4 7 2.7e-08 1.8e-06 28.4 2.2 1 23 215 237 215 237 0.98

5 7 2.2e-07 1.4e-05 25.6 1.3 1 23 243 265 243 265 0.97

6 7 4.9e-06 0.00031 21.3 5.9 1 23 271 293 271 293 0.97

7 7 2.6e-05 0.0016 19.1 0.8 1 22 299 320 299 320 0.95

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	3.5e-06	0.00022	21.8	1.4	1	23	129	151	129	151	0.97
2	7	1.3e-06	8.5e-05	23.1	2.1	2	23	160	181	160	181	0.97
3	7	3.2e-06	0.0002	21.9	0.8	1	23	187	209	187	209	0.99
4	7	2.7e-08	1.8e-06	28.4	2.2	1	23	215	237	215	237	0.98
5	7	2.2e-07	1.4e-05	25.6	1.3	1	23	243	265	243	265	0.97
6	7	4.9e-06	0.00031	21.3	5.9	1	23	271	293	271	293	0.97
7	7	2.6e-05	0.0016	19.1	0.8	1	22	299	320	299	320	0.95

Sequence Information

Coding Sequence: ATGTGTGAATGGCTGTCGCGCGACGAGTGGTGCGACGTGAGGCTGCTGTGCGGCGGCCGCGCGTTCGCCGCGCACCGCGCCGTCCTCGCCAGTGTCAGCTCTTTCCTCAGGCGATTACTGCTTTCATGTCCCATAGATGAGTCGCCGACGTTAATAGTCTTGCCCGACTTCGACCTAGAAGCTATGTCTGCGAAAGACAAAAATGATAGCAATAACAATATTCAAACAAAAGCAGCCTTCAGCGTCAAGGATAATTGTTCACTGCAATCGATAGATTTGCAAAGAACAGTAAATTTTCCTGGCTCCACTATTGGCGATGACACGGAACATGTCAATGATCAGGTTTTAACAACAACCGAACTAGCTATCTCGCGAACGAGCCGCTATGCATGCAGCGAGTGTGAAAAGACATTTTCTCAACTACGTAACTACAAGTACCATATGTCAGTGCACCGAGGCACCAAAGAGTTTGCGGCTTCATGCACCGTGTGCGGAAAATGCTTCAATGATAGAGGATATTTAAGCAGTCATATGAAAATACACAGAAATCGCAAAGAGTACAAATGCTCGCAATGCCCAAAGTCTTTCAATCAGCGAGTTGCCTACAATATGCATGTACGAATTCATACAGGTGTGAAACCGCACGTGTGCCCGCAGtgcggtaaagcgttctcgcgcaagatgttgctgaagcagcaccagcgcacgcactcgggcgagcggccctacgcctgcccgcactgcgacaagcgcttcgccgaccgctccaacatgacgctgcatctgcggctacacacagGAATAAAACCATTCAAGTGTCCGATGTGCCCCAAATCATTCACCAAGAATCACCATCTGAAGTCCCACGTTAACTTCCACACGGGAGCCAAGCCTTATTCCTGCCCACGTTGCAAGCTGGCTTTCACGCAGTCTTCGAACATGAGGACCCACCTCAAGAGATGCACTGCGCCGGAGCCGGCTAGCGATGACCAACTAGCTGCGTAG
Protein Sequence: MCEWLSRDEWCDVRLLCGGRAFAAHRAVLASVSSFLRRLLLSCPIDESPTLIVLPDFDLEAMSAKDKNDSNNNIQTKAAFSVKDNCSLQSIDLQRTVNFPGSTIGDDTEHVNDQVLTTTELAISRTSRYACSECEKTFSQLRNYKYHMSVHRGTKEFAASCTVCGKCFNDRGYLSSHMKIHRNRKEYKCSQCPKSFNQRVAYNMHVRIHTGVKPHVCPQCGKAFSRKMLLKQHQRTHSGERPYACPHCDKRFADRSNMTLHLRLHTGIKPFKCPMCPKSFTKNHHLKSHVNFHTGAKPYSCPRCKLAFTQSSNMRTHLKRCTAPEPASDDQLAA

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_01463474;
90% Identity: iTF_01463474;
80% Identity: iTF_01463474;