Basic Information

Insect: Tipula helvola
Gene Symbol: -
Assembly: GCA_963556165.1
Location: OY744481.1:225984746-225985715[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 1.9e-05 0.0069 19.6 1.6 1 23 87 110 87 110 0.93

2 7 0.00013 0.049 16.9 1.0 2 23 117 138 116 138 0.97

3 7 0.0003 0.11 15.8 0.8 1 23 144 168 144 168 0.97

4 7 1.2 4.6e+02 4.4 0.1 2 12 175 185 174 188 0.82

5 7 4e-05 0.015 18.5 2.1 1 23 199 221 199 221 0.96

6 7 5.5e-05 0.021 18.1 2.1 1 23 227 250 227 250 0.98

7 7 3.2e-05 0.012 18.8 2.6 1 23 255 278 255 278 0.94

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	1.9e-05	0.0069	19.6	1.6	1	23	87	110	87	110	0.93
2	7	0.00013	0.049	16.9	1.0	2	23	117	138	116	138	0.97
3	7	0.0003	0.11	15.8	0.8	1	23	144	168	144	168	0.97
4	7	1.2	4.6e+02	4.4	0.1	2	12	175	185	174	188	0.82
5	7	4e-05	0.015	18.5	2.1	1	23	199	221	199	221	0.96
6	7	5.5e-05	0.021	18.1	2.1	1	23	227	250	227	250	0.98
7	7	3.2e-05	0.012	18.8	2.6	1	23	255	278	255	278	0.94

Sequence Information

Coding Sequence: ATGAATGTGGAAAACACAGAAATCTTTGAAGAagattATGTTACCGAAGGTTTGGTTAGTTTTGATGAAGATAGTGGAGACGGAGATGAAAATGAACTGCTAGGAAATATAAAAAGCGAGAAATCGAATTGCAGTGAATATGATGATGAAGAAGAACTTTCAGATTGTCCTCCAGGAAACAAGCTTACTTGTTTAATCTGCCTTGAAATCCAAACTACAGATCTAGCCATGAAAGAACACTACAAGTTACATTTAAGGTATGCCTGCGATAAATGTGATAAACGTTTTGTCAAGGAGAGCTTGCTAAGGAAACACAAGTCGAACTCTCATttagaaagtaaaaatatcgaatGTCCGATATGCAAGTGCGTGTTCCGCGCAGTTTACAATTTGAAACAACATTTGTTTACACATTCCGAAGAGAGGACTTTTCAGTGCAGTTTTGAAACTTGTCGATTAAGTTTCAGACAAATTAGTTCCCTACAGGCTCACGAAAAGATACACAAAAATCAGCATCGGAAGAAATGTCCAATCTGTGATCAAATGGTTACTAAATTAGATACTCATATGTGGTCCCATTCCGACGAAAAACCGTACAAGTGTACCGAATGCACCAAATCATTTGCTTCCAAAACCCAGTTGGATATTCACTTTTACTCACATGAAAGTGACCGTCAATTTCGTTGTGAATTGTGTGATGCTTCTTTTAAATTTCGTAGTAGTTACCTCAAGCACAAAAATACTATACATGCAGAAACTAAATATCCGTGTTCTGTAtgcaaaagaaatttcaatcgAAAGGATAATATGAATAAGCACAAAAAGTTTGTACATCGTTTACTCgaataa
Protein Sequence: MNVENTEIFEEDYVTEGLVSFDEDSGDGDENELLGNIKSEKSNCSEYDDEEELSDCPPGNKLTCLICLEIQTTDLAMKEHYKLHLRYACDKCDKRFVKESLLRKHKSNSHLESKNIECPICKCVFRAVYNLKQHLFTHSEERTFQCSFETCRLSFRQISSLQAHEKIHKNQHRKKCPICDQMVTKLDTHMWSHSDEKPYKCTECTKSFASKTQLDIHFYSHESDRQFRCELCDASFKFRSSYLKHKNTIHAETKYPCSVCKRNFNRKDNMNKHKKFVHRLLE

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_01459007;
90% Identity: iTF_01460684;
80% Identity: -