Basic Information

Transcription Factor Domain

TF Family: TF_bZIP
Domain: bZIP domain
PFAM: AnimalTFDB
TF Group: Basic Domians group
Description: bZIP proteins are homo- or heterodimers that contain highly basic DNA binding regions adjacent to regions of α-helix that fold together as coiled coils
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.088 2.5e+02 4.2 0.0 34 63 12 41 2 43 0.69

2 4 0.0074 21 7.6 0.0 26 63 32 69 29 71 0.91

3 4 0.0028 8 9.0 0.0 26 63 60 97 57 104 0.91

4 4 0.016 44 6.6 0.0 26 63 102 139 100 141 0.82

#	of	c-Evalue	i-Evalue	score	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.088	2.5e+02	4.2	34	63	12	41	2	43	0.69
2	4	0.0074	21	7.6	26	63	32	69	29	71	0.91
3	4	0.0028	8	9.0	26	63	60	97	57	104	0.91
4	4	0.016	44	6.6	26	63	102	139	100	141	0.82

Coding Sequence: atgacccgcaatacacgcacactggacacgccggtccgctcactggacacgcaggtccacacactggacacgcaggtccgctcactggacacgcaggtccacacactggacacgcaggtccgctcactggacacgccggtccgcacactggacacgccggtccgctcactggacacgcaggtccacacactggacacgcaggtccgctcactggacacgcaggtccacacactggacacgccggtccactcactggacacgcaggtccacacactggacacgcaggtccgctcactggacacgcaggtccacacactggacacgcaggtccgctcactggacacgcaggtccgctcactggacacgccggtccgctcactggacacgcaggtccgctcactggacacgcaggtccactcactggacacgccggtccgctcactggacacgccggtccgctcactcgccacacgaactcCTGGACTCTTCAGTCGCGAGCCAATAACTCCActcaggctaccgctgagcttgtatttatag
Protein Sequence: MTRNTRTLDTPVRSLDTQVHTLDTQVRSLDTQVHTLDTQVRSLDTPVRTLDTPVRSLDTQVHTLDTQVRSLDTQVHTLDTPVHSLDTQVHTLDTQVRSLDTQVHTLDTQVRSLDTQVRSLDTPVRSLDTQVRSLDTQVHSLDTPVRSLDTPVRSLATRTPGLFSREPITPLRLPLSLYL*

Sequence clustering based on sequence similarity using MMseqs2