Basic Information

Transcription Factor Domain

TF Family: TF_bZIP
Domain: bZIP domain
PFAM: AnimalTFDB
TF Group: Basic Domians group
Description: bZIP proteins are homo- or heterodimers that contain highly basic DNA binding regions adjacent to regions of α-helix that fold together as coiled coils
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.19 5.5e+02 3.1 0.0 33 63 4 34 1 36 0.83

2 6 0.0042 12 8.4 0.0 26 63 25 62 22 64 0.90

3 6 0.0034 9.7 8.7 0.0 26 63 53 90 51 92 0.91

4 6 0.0069 19 7.7 0.0 26 63 95 132 92 134 0.90

5 6 0.012 35 6.9 0.0 26 60 123 157 120 162 0.89

6 6 0.18 5.1e+02 3.2 0.0 35 60 132 157 130 175 0.61

#	of	c-Evalue	i-Evalue	score	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.19	5.5e+02	3.1	33	63	4	34	1	36	0.83
2	6	0.0042	12	8.4	26	63	25	62	22	64	0.90
3	6	0.0034	9.7	8.7	26	63	53	90	51	92	0.91
4	6	0.0069	19	7.7	26	63	95	132	92	134	0.90
5	6	0.012	35	6.9	26	60	123	157	120	162	0.89
6	6	0.18	5.1e+02	3.2	35	60	132	157	130	175	0.61

Coding Sequence: atgacccgcaatacacgaacactggactcgccggtccgcacactggacacgccggtccgctcactggacacgcaggtccacacactggacacgcaggtccgctcactggacacgcaggtccacacactggacacgccggtccgctcactggacacgcaggtccacacactggacacgcaggtccgctcactggacacgcaggtccgcacactggacacgccggtccgctcactggacacgcaggtccacacactggacacgcaggtccgctcactggacacgcaggtccacacactggacacgcaggtccgctcactggacacgcaggtccactcactggacacgccggtccgctcactggacacgcaggtccacacactggacacgcaggtccgctcactggacacgcaggtccacacactggacacgccggtccgctcactggacacgcaggtccacacactggactcgccggtccgctcactggacacgcaggtccgctcactggacacgccggtccactcccatgccgtacacactaccgcGGCACGCGCCACGCGAACTCCCGGACTCTTCAGTCGCGAGCCAAGAACTGccctgaggctaccgctgagcttgtatttatag
Protein Sequence: MTRNTRTLDSPVRTLDTPVRSLDTQVHTLDTQVRSLDTQVHTLDTPVRSLDTQVHTLDTQVRSLDTQVRTLDTPVRSLDTQVHTLDTQVRSLDTQVHTLDTQVRSLDTQVHSLDTPVRSLDTQVHTLDTQVRSLDTQVHTLDTPVRSLDTQVHTLDSPVRSLDTQVRSLDTPVHSHAVHTTAARATRTPGLFSREPRTALRLPLSLYL*

Sequence clustering based on sequence similarity using MMseqs2