Basic Information

Insect: Timema podura
Gene Symbol: ZBTB46
Assembly: GCA_033556935.1
Location: JAVRXN010000013.1:17543413-17548264[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 1.9e-07 3.8e-05 25.7 0.8 1 23 10 32 10 32 0.99

2 9 0.0028 0.53 12.6 0.7 2 23 39 59 39 59 0.90

3 9 5.2e-08 1e-05 27.5 2.2 1 23 65 87 65 87 0.98

4 9 2.2e-06 0.00043 22.4 1.2 1 23 93 116 93 116 0.97

5 9 2.7 5.2e+02 3.2 1.9 14 23 116 125 115 125 0.91

6 9 5.1e-07 9.8e-05 24.4 1.3 1 23 131 153 131 153 0.99

7 9 0.0017 0.34 13.2 0.1 2 23 160 180 160 180 0.95

8 9 5.2e-08 1e-05 27.5 2.2 1 23 186 208 186 208 0.98

9 9 1.7e-06 0.00032 22.8 1.6 1 23 214 236 214 236 0.99

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	1.9e-07	3.8e-05	25.7	0.8	1	23	10	32	10	32	0.99
2	9	0.0028	0.53	12.6	0.7	2	23	39	59	39	59	0.90
3	9	5.2e-08	1e-05	27.5	2.2	1	23	65	87	65	87	0.98
4	9	2.2e-06	0.00043	22.4	1.2	1	23	93	116	93	116	0.97
5	9	2.7	5.2e+02	3.2	1.9	14	23	116	125	115	125	0.91
6	9	5.1e-07	9.8e-05	24.4	1.3	1	23	131	153	131	153	0.99
7	9	0.0017	0.34	13.2	0.1	2	23	160	180	160	180	0.95
8	9	5.2e-08	1e-05	27.5	2.2	1	23	186	208	186	208	0.98
9	9	1.7e-06	0.00032	22.8	1.6	1	23	214	236	214	236	0.99

Sequence Information

Coding Sequence: ATGGTCTGTCATCTTGCGGTGAAGCCGTTCGAATGTAACCAGTGTGGGAAGCGCATTGCAAGCAGATCTTCCCTGAAGAACCACATCAGGACCCACACGGGCGAGCGTCCCGCTGTCTGCAACGTTTGTGGCAAGGCTTTCCCTCGTCCCTACATCGCCACCCATATGCGTTCACACACTGGCGCTAAACCTTTCACCTGCACCACTTGTGACAAAAGTTTCACCCAGCGGTCCACTCTTGTGATCCACCAAAGATCCCACACAGGACTTAGACCATATCAATGTCCCACCTGCAGCAAGGCCTTTGTCACAAAGACTCTTTTGAACTATCACCAGAagTGGTCGCATAACCTCAGGAACCATATGGTCACTCATCTTGCGGTGAAGCCATTTGAGTGTAACCAGTGTGGGAAGCTCGTCACAAGCAAATATTCACTAAAGAACCACATCAGGACCCACACTGGCGAGCGTCCCGCAGTCTGCAATGTTTGCGGCAAGGCCTTCGCTCGTGGCTACATCGCCACTCACATGCGTTCACACACTGGCGCTAAACCTTTCACCTGCACCACTTGTGACAAAAGTTTCACCCAGCGGTCCACTCTTGTAATCCACCAAAGATCCCACACAGGACTTAGACCATATCAATGTCCCACCTGCAGCAAAGACTTTGTCACCAAGACTCTTTTGAAATATCACCAGAAggtgcatttaaaataa
Protein Sequence: MVCHLAVKPFECNQCGKRIASRSSLKNHIRTHTGERPAVCNVCGKAFPRPYIATHMRSHTGAKPFTCTTCDKSFTQRSTLVIHQRSHTGLRPYQCPTCSKAFVTKTLLNYHQKWSHNLRNHMVTHLAVKPFECNQCGKLVTSKYSLKNHIRTHTGERPAVCNVCGKAFARGYIATHMRSHTGAKPFTCTTCDKSFTQRSTLVIHQRSHTGLRPYQCPTCSKDFVTKTLLKYHQKVHLK

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -