Basic Information

Insect: Timema genevievae
Gene Symbol: -
Assembly: GCA_902155825.1
Location: CABFWO010002107.1:109802-110581[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 5.9e-06 0.0011 21.2 2.3 1 23 10 32 10 32 0.98

2 9 1.6e-05 0.0029 19.9 0.3 1 23 38 60 38 60 0.98

3 9 2.4e-06 0.00045 22.5 2.0 1 23 66 88 66 88 0.97

4 9 1.5e-05 0.0029 19.9 5.5 1 23 93 115 93 115 0.98

5 9 2.9e-05 0.0054 19.1 1.2 1 21 124 144 124 146 0.94

6 9 4.7e-07 8.8e-05 24.7 0.3 1 23 152 174 152 174 0.98

7 9 3.8e-05 0.0071 18.7 2.4 1 21 180 200 180 202 0.95

8 9 3e-08 5.5e-06 28.5 1.0 1 23 208 230 208 230 0.98

9 9 0.0051 0.96 12.0 3.7 1 21 236 256 236 258 0.95

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	5.9e-06	0.0011	21.2	2.3	1	23	10	32	10	32	0.98
2	9	1.6e-05	0.0029	19.9	0.3	1	23	38	60	38	60	0.98
3	9	2.4e-06	0.00045	22.5	2.0	1	23	66	88	66	88	0.97
4	9	1.5e-05	0.0029	19.9	5.5	1	23	93	115	93	115	0.98
5	9	2.9e-05	0.0054	19.1	1.2	1	21	124	144	124	146	0.94
6	9	4.7e-07	8.8e-05	24.7	0.3	1	23	152	174	152	174	0.98
7	9	3.8e-05	0.0071	18.7	2.4	1	21	180	200	180	202	0.95
8	9	3e-08	5.5e-06	28.5	1.0	1	23	208	230	208	230	0.98
9	9	0.0051	0.96	12.0	3.7	1	21	236	256	236	258	0.95

Sequence Information

Coding Sequence: ATGCTTCAACACACGACGGATCAGCCTTACTCGTGCGACATTTGCAACAAGGCCTTCAGGCATGAGTATGCGTTGATCAATCACAAAAAATATCACGCAGGCATAAAAGAGTTTGTCTGCGACATATGCAACTATGCGTCCGATCGCAAAGCCTCCCTGAAAATACACATCAAGAGACATACACGCGAAGCCCTTCACCCCTGCAACATGTGCGAGAAAAGTTTCTACACAAATTCCGAACTGAAAGTACACAAGAATATACACTTTGGCAAGATGCACAAATGTGAAATTTGCGACAGGTCGTTCACGCACAAAAGGAACATGTTGTTACATCAGCAGTCCCACGACCCGATGAAGGAGGTGAGGGTATTTCCGTGCGAGATTTGCGGTAAGACCTACCGCCGCAAGACCAGGCTAGCCGTGCACATCATGTGCCACAAGGGGGAGGGCAAGTTTGTATGCGACGTATGCGGAAAGATCGTGACGAGTAGCAGCTCCTTGAAAACACACAGGCGAGTTCACACAGGAGAGAAACCGTACGTGTGTGACCTGTGCGGGAAGGCGTTCAACTCGTCCAACTATCTGCGCGTGCATAAACGGTGTCATACCGGGGAGAAACCCCATACATGCGAGCGGTGTGGTAAATCCTTCACTCAGCGCTCGGCGCTCATTGTGCATATTAGGGTTCACACCGGCCAAAGGCCTTACGAGTGTCGCATATGCTACAGACAGTTTATTACCAGGACACTGTTGAATACTCATTTGAAATGTCACGAGTAA
Protein Sequence: MLQHTTDQPYSCDICNKAFRHEYALINHKKYHAGIKEFVCDICNYASDRKASLKIHIKRHTREALHPCNMCEKSFYTNSELKVHKNIHFGKMHKCEICDRSFTHKRNMLLHQQSHDPMKEVRVFPCEICGKTYRRKTRLAVHIMCHKGEGKFVCDVCGKIVTSSSSLKTHRRVHTGEKPYVCDLCGKAFNSSNYLRVHKRCHTGEKPHTCERCGKSFTQRSALIVHIRVHTGQRPYECRICYRQFITRTLLNTHLKCHE*

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_01448837;
90% Identity: iTF_01448837;
80% Identity: -