Basic Information

Transcription Factor Domain

TF Family: TF_bZIP
Domain: bZIP domain
PFAM: AnimalTFDB
TF Group: Basic Domians group
Description: bZIP proteins are homo- or heterodimers that contain highly basic DNA binding regions adjacent to regions of α-helix that fold together as coiled coils
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.091 3.6e+02 3.2 0.0 30 57 24 51 14 61 0.54

2 7 0.0017 6.7 8.8 0.0 26 63 76 113 68 130 0.85

3 7 0.016 63 5.6 0.1 27 58 147 178 137 185 0.50

4 7 0.0084 33 6.6 0.1 27 64 168 205 165 206 0.84

5 7 0.011 41 6.2 0.2 26 62 195 231 187 234 0.71

6 7 0.013 51 5.9 0.2 27 58 224 255 214 262 0.52

7 7 0.028 1.1e+02 4.9 0.1 27 58 259 290 257 292 0.84

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.091	3.6e+02	3.2	0.0	30	57	24	51	14	61	0.54
2	7	0.0017	6.7	8.8	0.0	26	63	76	113	68	130	0.85
3	7	0.016	63	5.6	0.1	27	58	147	178	137	185	0.50
4	7	0.0084	33	6.6	0.1	27	64	168	205	165	206	0.84
5	7	0.011	41	6.2	0.2	26	62	195	231	187	234	0.71
6	7	0.013	51	5.9	0.2	27	58	224	255	214	262	0.52
7	7	0.028	1.1e+02	4.9	0.1	27	58	259	290	257	292	0.84

Coding Sequence: ATGTTCAAGGTTTtgactattaaaactaaaacatacatacacacactgctggacacgcaggtccgcacactggacacgcaggtccgctcactggacacgcaggtccgcacactggacacgcaggtTCGCTCACTGGACACGCCggtccactcactggacacgccggtccactcactggacacgccgGTCCACTCACAGGACACGCAGGTCCGCTCACTGGACACGCaggtccacacactggacacgcaggtccacacactggacacgcaggtccgcacactggacacgcaggtCCGCTCACTGGACAAGCAGGTCCGcacactggacacgcaggtTCGCTCACTGGACACGCCggtccactcactggacacgccggtccactcactggacacgccgGTCCACTCACAGGACACGCAGGTCCGCTCACTGGACACGCaggtccacacactggacacgcaggtccacacactggacacgcaggtccgcacactggacacgcaggtccgcacactggacacgcaggtccgctcactggacacgcaggtccgctcactggacacgcaggtccgctcactggacacgcaggtccacacactggacacgcaggtccgcacactggacacgcaggtccgcacactggacacgcaggtccgctcactggacacgcaggtccgctcactggacacgcaggtccgctcactggacacgcaggtccgctcactggacacgcaggtccgctcactggacacgcaggtccgctcactggacacgcaggtccgcacactggacacgcaggtccgcacactggacacgcaggtccgcacactggacacgcaggtCCGCTCACTGGACACGCAGGTCCACACACTTCACTGTCCACAACTTGGACTAGCGGACTAG
Protein Sequence: MFKVLTIKTKTYIHTLLDTQVRTLDTQVRSLDTQVRTLDTQVRSLDTPVHSLDTPVHSLDTPVHSQDTQVRSLDTQVHTLDTQVHTLDTQVRTLDTQVRSLDKQVRTLDTQVRSLDTPVHSLDTPVHSLDTPVHSQDTQVRSLDTQVHTLDTQVHTLDTQVRTLDTQVRTLDTQVRSLDTQVRSLDTQVRSLDTQVHTLDTQVRTLDTQVRTLDTQVRSLDTQVRSLDTQVRSLDTQVRSLDTQVRSLDTQVRSLDTQVRTLDTQVRTLDTQVRTLDTQVRSLDTQVHTLHCPQLGLAD*

Sequence clustering based on sequence similarity using MMseqs2