Basic Information

Insect: Timema bartmani
Gene Symbol: Zfy1
Assembly: GCA_902151455.1
Location: CABFWB010000211.1:278534-279475[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 0.0005 0.11 15.1 0.6 2 23 36 57 35 57 0.95

2 10 0.00046 0.1 15.3 0.7 1 23 61 84 61 84 0.95

3 10 8.5 1.9e+03 1.8 0.9 2 23 90 111 90 111 0.88

4 10 0.004 0.9 12.3 0.6 1 19 117 135 117 140 0.94

5 10 0.00042 0.095 15.4 6.8 1 23 146 168 146 168 0.97

6 10 6.3e-05 0.014 18.0 0.5 1 23 178 200 178 200 0.97

7 10 0.0005 0.11 15.1 0.0 2 23 207 228 206 228 0.97

8 10 3.6e-08 8.2e-06 28.1 1.4 1 23 234 256 234 256 0.98

9 10 9.4e-07 0.00021 23.7 1.4 1 23 262 284 262 284 0.99

10 10 0.062 14 8.5 7.3 1 23 290 312 290 312 0.99

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	0.0005	0.11	15.1	0.6	2	23	36	57	35	57	0.95
2	10	0.00046	0.1	15.3	0.7	1	23	61	84	61	84	0.95
3	10	8.5	1.9e+03	1.8	0.9	2	23	90	111	90	111	0.88
4	10	0.004	0.9	12.3	0.6	1	19	117	135	117	140	0.94
5	10	0.00042	0.095	15.4	6.8	1	23	146	168	146	168	0.97
6	10	6.3e-05	0.014	18.0	0.5	1	23	178	200	178	200	0.97
7	10	0.0005	0.11	15.1	0.0	2	23	207	228	206	228	0.97
8	10	3.6e-08	8.2e-06	28.1	1.4	1	23	234	256	234	256	0.98
9	10	9.4e-07	0.00021	23.7	1.4	1	23	262	284	262	284	0.99
10	10	0.062	14	8.5	7.3	1	23	290	312	290	312	0.99

Sequence Information

Coding Sequence: ATGCCAAACGTAGCTTCAGTTTTAAAACAGAACATTGTCCGCGATAAGACCCCCGAGAAGGTTTCGGTGAAAGAGTCTTTAGTCGACGGTGGCAGGATTCAGTGGAGGTGCAAGGTCTGCAATAAGATCTTCCGACAGGATTGGCAGTACAAACTTCATCTCGTGTCTCATGTGAAAGAGTACACTTGCAACATCTGTAAGACAAAGTTTGTAAGCGAAGAAGCGCTCTCTCTCCACAAGACGAGGTTACACCTCAACAAAAAGAATGTGTGTTCAGTTTGTGATTTTTCCCACGATAGCAAATTTGTTCTTGATTTACACCAGAAAGCTCATTTCTCTAAAGTGAAGCATGTTTGCAGCACTTGTTCTAAAGAGTTTAAAACTGAACAGTCGCTAATCGATCACGATTTGTTAGCACACACTGGGATCAATCCGTTTAGATGTGATCACTGCGGGAAAAGATacaagtcaaaatattatttaaaattccaccAGAAATTACACGAACCGGGTTTCAAGGACAACCCAAAGTATTACTGTGAGATTTGTGGGAAAGGTTTCTTGTACAAATCGGCATTGAATAATCACCGAGAGAACCATCTGGGCAGCAATAAGGTCGTGTGCACCATTTGTGATGTGCCGCTCGCGTCGAAAAAATACATGACGGTCCACATGCGAATACACAGCGGAGAAAAACCGTTTGTTTGTGATGTTTGTGGCAAGGCGTTTGTCACTAACAAGCATTTAACGGTTCACCGACGCACACATACGGGGGAAAAACTTTACACATGTAACGTGTGTAACAAATCATTCACGCAAGTGGGTTATTTGACAATTCACAAGCGCTCTCATACTGGCGAGCGCCCATATCGGTGTGAGACGTGCTGTAAAGACTTTGCTTCCAGATGTCAACTCAACTCTCATCGTAAATCACATAGATAA
Protein Sequence: MPNVASVLKQNIVRDKTPEKVSVKESLVDGGRIQWRCKVCNKIFRQDWQYKLHLVSHVKEYTCNICKTKFVSEEALSLHKTRLHLNKKNVCSVCDFSHDSKFVLDLHQKAHFSKVKHVCSTCSKEFKTEQSLIDHDLLAHTGINPFRCDHCGKRYKSKYYLKFHQKLHEPGFKDNPKYYCEICGKGFLYKSALNNHRENHLGSNKVVCTICDVPLASKKYMTVHMRIHSGEKPFVCDVCGKAFVTNKHLTVHRRTHTGEKLYTCNVCNKSFTQVGYLTIHKRSHTGERPYRCETCCKDFASRCQLNSHRKSHR*

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_01449892; iTF_01448909;
90% Identity: iTF_01448909;
80% Identity: -