Basic Information

Insect: Thumatha senex
Gene Symbol: esg
Assembly: GCA_948477245.1
Location: OX419727.1:17996307-17997893[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 1.9e-06 0.00019 22.6 2.4 1 23 209 231 209 231 0.98

2 5 2.6e-06 0.00026 22.2 0.6 1 23 244 266 244 266 0.98

3 5 2.5e-07 2.5e-05 25.4 0.7 2 23 271 292 270 292 0.97

4 5 5e-07 5e-05 24.5 2.3 1 23 298 320 298 320 0.98

5 5 2e-06 0.0002 22.5 0.2 1 20 326 345 326 347 0.95

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	1.9e-06	0.00019	22.6	2.4	1	23	209	231	209	231	0.98
2	5	2.6e-06	0.00026	22.2	0.6	1	23	244	266	244	266	0.98
3	5	2.5e-07	2.5e-05	25.4	0.7	2	23	271	292	270	292	0.97
4	5	5e-07	5e-05	24.5	2.3	1	23	298	320	298	320	0.98
5	5	2e-06	0.0002	22.5	0.2	1	20	326	345	326	347	0.95

Sequence Information

Coding Sequence: ATGCTCGTGGAGGACTTTCAAACGACTCGTGCTTTGATGACAAAGAAATATGCGCATTGCCCGCTGAAGAAACGGCCGGTGATGGTTCGGGAGGAGCGGCCGGCGACACCGCCCACCACGCCGCCTCATCCCGCCCACCTCGCCACGCGCCTCTACTACGATCATCATTATGATACAGAAAATGATGAACCACAAAACCTAAGTACCAAACCTGAAGATTTATCTAAGACTGGCAATTACCCTAGCAAAGCGTCATTTCCAGTAACAACAGCAGCTTTGAAAATAGAACCGAAGATAGAACTGAAAGTAGAACCTAGAGAGTGGCCACAACAACTAGATTATTTGTCTGCTTGCCGCGCAAGACTCGAACCACCTGCTGAACTCGCCCGGCCCACACCTCAATACGCTTATCTACCAGCACTGTACGCACCATACCCTCTTGAAGAACTGTACCCAGCGGCGCCATCGCTATCACCGCCGGTGCACCCTCAGATGTACTCTCACTATTCACCTGCTTCACCTCCTTCATCGTGTTCACCGCCACCGTGTCCAGAAGACTTGCGTTCTCCTGGCTCTGTATCTTCTGACTCGGGCATATCGGTgtcagcacctcgccgtccacggtaccagtgtccagattgtgccaaatcttactccacgtattctggtctaaccaaacaccagcaacaccattgcgccttagctgaaggcagtcttgtacgtaaatcgttcagctgtaagtactgtgcaaaagtgtacacatctcttggtgctctcaagatgcatatccgaacccacacgctgccatgcaagtgcgacttgtgcggtaaagctttctcgaggccatggctattacagggccatattcgtacacatactggtgaaaagcctttctcttgtcagcattgtcgacgcgcctttgctgataggtcaaatttacgagctcacctccaaacgcattcagatgttaaaaagtattcatgttcgggttgtgggaagacgttttctcgtatgtcccttctaagcaaacattTGGAAGGTGGCTGTAGCGTACATGGTGCTTCACCTTATGAGTTCAGACCTGAAGCGGTACCGGCTTCACATACACACCAACAGATGTCTCCAACTGCCACTGTTCATGCATATTAG
Protein Sequence: MLVEDFQTTRALMTKKYAHCPLKKRPVMVREERPATPPTTPPHPAHLATRLYYDHHYDTENDEPQNLSTKPEDLSKTGNYPSKASFPVTTAALKIEPKIELKVEPREWPQQLDYLSACRARLEPPAELARPTPQYAYLPALYAPYPLEELYPAAPSLSPPVHPQMYSHYSPASPPSSCSPPPCPEDLRSPGSVSSDSGISVSAPRRPRYQCPDCAKSYSTYSGLTKHQQHHCALAEGSLVRKSFSCKYCAKVYTSLGALKMHIRTHTLPCKCDLCGKAFSRPWLLQGHIRTHTGEKPFSCQHCRRAFADRSNLRAHLQTHSDVKKYSCSGCGKTFSRMSLLSKHLEGGCSVHGASPYEFRPEAVPASHTHQQMSPTATVHAY

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00346115;
90% Identity: -
80% Identity: -