Basic Information

Transcription Factor Domain

TF Family: zf-BED
Domain: zf-BED domain
PFAM: PF02892
TF Group: Zinc-Coordinating Group
Description: The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.2 86 2.9 0.3 21 38 2 20 1 24 0.82

2 8 0.021 8.9 6.1 2.2 13 39 22 45 16 49 0.82

3 8 0.00015 0.062 13.0 2.6 13 38 50 76 43 80 0.86

4 8 0.011 4.8 7.0 0.5 16 39 81 101 77 106 0.83

5 8 0.49 2.1e+02 1.7 3.3 14 26 107 119 102 132 0.81

6 8 0.0031 1.3 8.8 1.7 13 41 134 159 123 161 0.80

7 8 0.0021 0.88 9.3 1.1 17 41 166 187 158 189 0.88

8 8 0.032 14 5.5 0.8 17 30 194 209 188 214 0.75

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.2	86	2.9	0.3	21	38	2	20	1	24	0.82
2	8	0.021	8.9	6.1	2.2	13	39	22	45	16	49	0.82
3	8	0.00015	0.062	13.0	2.6	13	38	50	76	43	80	0.86
4	8	0.011	4.8	7.0	0.5	16	39	81	101	77	106	0.83
5	8	0.49	2.1e+02	1.7	3.3	14	26	107	119	102	132	0.81
6	8	0.0031	1.3	8.8	1.7	13	41	134	159	123	161	0.80
7	8	0.0021	0.88	9.3	1.1	17	41	166	187	158	189	0.88
8	8	0.032	14	5.5	0.8	17	30	194	209	188	214	0.75

Coding Sequence: ATGGTTTGTAACAAGAAGTTTGCCCAACGCGGTTCTCTCACAACTCATCTAGAAACCCATACAGAAGAGAAGCCTTTCCAGTGCACAGTTTGTAATAAGAAATTTGGCCGTCGAAGTACTCTCGCAACTCATCTAAACATCCATACAGGGGAGAAGTCTTTTGAGTGCATGGTTTGTAACAAGAAGTTTGCCCAACGCGGTTCTCTCACAACTCATCTTAGAACCCATACAGAAGAGAAGCCTTTCCAGTGCACAGTTTGTAATAAGAAATTTGGCCGTCGAAGTACTCTCGCAACTCATCTAAACATCCATACAGGGGAGAAGTCTTTCAAATGCATGGTTTGCAGCAAGAATTTTTGTCAAGCATTTAAACTTAAAATACATCTGAGAACCcatacaggggagaagcctttccagTGCACAGTTTGTAATAAGAAATTTGGCCGTCGAAGTACTCTCGCAACTCATCTCAGAACCCataccggggagaagccttttgagtgcacagtttgtAACAAGAATTTTAGGGATGGATCTAATCTTAAAATACATCTGAGAACCcatacaggggagaagcctttcgagtgcatgGTTTGTAATAAGAAGTTTACCAAGTGGTTCTCTCACAACTCATCTCAGAACCcatacaggggagaagcctttcgagtgcatgGTTTGTAA
Protein Sequence: MVCNKKFAQRGSLTTHLETHTEEKPFQCTVCNKKFGRRSTLATHLNIHTGEKSFECMVCNKKFAQRGSLTTHLRTHTEEKPFQCTVCNKKFGRRSTLATHLNIHTGEKSFKCMVCSKNFCQAFKLKIHLRTHTGEKPFQCTVCNKKFGRRSTLATHLRTHTGEKPFECTVCNKNFRDGSNLKIHLRTHTGEKPFECMVCNKKFTKWFSHNSSQNPYRGEAFRVHGL

Sequence clustering based on sequence similarity using MMseqs2